top of page

mmu_circBpnt1_552

Basic information of circular RNA
PanCircBase ID:

mmu_circBpnt1_552

mm39_Chr. Position ID:

chr1|185073419|185084576|+

Gene name:

Bpnt1

Transcript:

ENSMUST00000027916.13

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

5

Exon/intron indexes:

3,4,5,6,7

Exon/intron offsets:

0,4092,5452,7521,10959

Genomic length:

11157

Exon/intron sizes in nt:

10,51,08,49,92,198

Flanking exon/introns:

chr1:185070429-185073419|chr1:185084576-185086153

Splice length:

552

Other database IDs:

circBase: mmu_circ_0008538

Human Ortholog IDs:
Mature spliced Sequence:

ACCTCGGCCACCGACCTGCAGACCAAAGCCGACCGCTTGGTGCAGATGAGCATATGCTCTTCCCTGGCCCGGAAGTTCCCGAAGCTGACCATCATAGGGGAAGAGGACCTGCCTCCTGGGGAAGTGGATCAAGAGCTGATTGAAGACGGGCAGTGGGAGGAGATCCTGAAGCAGCCGTGCCCCTCGCAGTACAGTGCTATCAAGGAGGAAGACCTTGTGGTTTGGGTTGACCCCTTAGATGGCACCAAGGAGTACACTGAAGGTCTTCTTGACAATGTAACAGTTCTCATTGGGATTGCTTATGAAGGAAAGGCCATCGCAGGCATCATCAACCAGCCGTATTACAACTACCAGGCAGGACCCGACGCGGCGCTGGGCAGGACCATCTGGGGAGTTCTGGGTTTGGGTGCTTTTGGGTTTCAGCTGAAGGAAGCCCCTGCCGGGAAGCACATTATCACAACCACCAGATCCCATAGCAACCAGCTGGTCACAGACTGCATTTCCGCCATGAACCCCGACACCGTGCTGCGAGTGGGAGGAGCAGGAAACAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

AGACTGCATTTCCGCCATGA

60.04

TGGTCAGCTTCGGGAACTTC

59.97

152

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

AGACTGCATTTCCGCCATGA

60.04

TGATGGTCAGCTTCGGGAAC

60.04

155

PCR template sequence:

TATCACAACCACCAGATCCCATAGCAACCAGCTGGTCACAGACTGCATTTCCGCCATGAACCCCGACACCGTGCTGCGAGTGGGAGGAGCAGGAAACAAGACCTCGGCCACCGACCTGCAGACCAAAGCCGACCGCTTGGTGCAGATGAGCATATGCTCTTCCCTGGCCCGGAAGTTCCCGAAGCTGACCATCATAGGGG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

5

Interacting miRNAs (#binding sites)

mmu-miR-135a-5p(1), mmu-miR-146a-5p(1), mmu-miR-216a-5p(1), mmu-miR-1198-5p(1), mmu-miR-146b-5p(1)

siRNAs for circular RNA silencing
Junction sequence

AGCAGGAAACAAGACCTCGGCCACCG

siRNA sets

TGGCCGAGGTCTTGTTTCC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBPNT1_552_ORF_1

1.2541

0.418729253

0.998369706

1059

ORF sequence:

ATGAGCATATGCTCTTCCCTGGCCCGGAAGTTCCCGAAGCTGACCATCATAGGGGAAGAGGACCTGCCTCCTGGGGAAGTGGATCAAGAGCTGATTGAAGACGGGCAGTGGGAGGAGATCCTGAAGCAGCCGTGCCCCTCGCAGTACAGTGCTATCAAGGAGGAAGACCTTGTGGTTTGGGTTGACCCCTTAGATGGCACCAAGGAGTACACTGAAGGTCTTCTTGACAATGTAACAGTTCTCATTGGGATTGCTTATGAAGGAAAGGCCATCGCAGGCATCATCAACCAGCCGTATTACAACTACCAGGCAGGACCCGACGCGGCGCTGGGCAGGACCATCTGGGGAGTTCTGGGTTTGGGTGCTTTTGGGTTTCAGCTGAAGGAAGCCCCTGCCGGGAAGCACATTATCACAACCACCAGATCCCATAGCAACCAGCTGGTCACAGACTGCATTTCCGCCATGAACCCCGACACCGTGCTGCGAGTGGGAGGAGCAGGAAACAAGACCTCGGCCACCGACCTGCAGACCAAAGCCGACCGCTTGGTGCAGATGAGCATATGCTCTTCCCTGGCCCGGAAGTTCCCGAAGCTGACCATCATAGGGGAAGAGGACCTGCCTCCTGGGGAAGTGGATCAAGAGCTGATTGAAGACGGGCAGTGGGAGGAGATCCTGAAGCAGCCGTGCCCCTCGCAGTACAGTGCTATCAAGGAGGAAGACCTTGTGGTTTGGGTTGACCCCTTAGATGGCACCAAGGAGTACACTGAAGGTCTTCTTGACAATGTAACAGTTCTCATTGGGATTGCTTATGAAGGAAAGGCCATCGCAGGCATCATCAACCAGCCGTATTACAACTACCAGGCAGGACCCGACGCGGCGCTGGGCAGGACCATCTGGGGAGTTCTGGGTTTGGGTGCTTTTGGGTTTCAGCTGAAGGAAGCCCCTGCCGGGAAGCACATTATCACAACCACCAGATCCCATAGCAACCAGCTGGTCACAGACTGCATTTCCGCCATGAACCCCGACACCGTGCTGCGAGTGGGAGGAGCAGGAAACAAG

Peptide sequence:

MSICSSLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNK

IRESfinder result

IRESfinder score

0.412570445

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page