top of page

mmu_circBirc6_360

Basic information of circular RNA
PanCircBase ID:

mmu_circBirc6_360

mm39_Chr. Position ID:

chr17|74984160|74996358|+

Gene name:

Birc6

Transcript:

ENSMUST00000180037.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

65,66

Exon/intron offsets:

0,12052

Genomic length:

12198

Exon/intron sizes in nt:

2,14,146

Flanking exon/introns:

chr17:74977377-74984160|chr17:74996358-74997352

Splice length:

360

Other database IDs:

circBase: hsa_circ_0119852, circAtlas: hsa-BIRC6_0085, CIRCpedia: HSA_CIRCpedia_40936

Human Ortholog IDs:
Mature spliced Sequence:

TTCTGGACATGGCAAGACATGTGCCACTCTATCGTGCTCTGCTAGAGTTGCTCCGCGCCATTGCTTCTTGCACATCTATGGTGCCGCTGTTGTTGCCTCTTTCTACAGAGAATGGTGAAGAAGAGGAAGATGAACAGTCAGAATGTCAAACTTCTGTTGGTACATTATTAGCTAAAATGAAGACCTGTGTCGATACCTACACCAACCGCCTAAGATCTAAAAGGGAAAATGTGAAAGCCGGAGTCAAGCCGGACGCGCCTGATCAAGAGCCCGAAGGACTTGCGCTTCTGGTCCCCGACATCCAGAGGACTGCTGAGATCGTCCACGCCGCCACCGCCAATCTGCGGCAAGCCAATCAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CGACATCCAGAGGACTGCTG

60.18

AACAACAGCGGCACCATAGA

59.96

159

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GGACTGCTGAGATCGTCCAC

60.18

AACAACAGCGGCACCATAGA

59.96

148

PCR template sequence:

GATCAAGAGCCCGAAGGACTTGCGCTTCTGGTCCCCGACATCCAGAGGACTGCTGAGATCGTCCACGCCGCCACCGCCAATCTGCGGCAAGCCAATCAAGTTCTGGACATGGCAAGACATGTGCCACTCTATCGTGCTCTGCTAGAGTTGCTCCGCGCCATTGCTTCTTGCACATCTATGGTGCCGCTGTTGTTGCCTCT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-211-5p(1), mmu-miR-204-5p(1), mmu-miR-542-5p(1)

siRNAs for circular RNA silencing
Junction sequence

CAAGCCAATCAAGTTCTGGACATGGC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBIRC6_360_ORF_1

1.1024

0.27454755

0.954498562

711

ORF sequence:

ATGGCAAGACATGTGCCACTCTATCGTGCTCTGCTAGAGTTGCTCCGCGCCATTGCTTCTTGCACATCTATGGTGCCGCTGTTGTTGCCTCTTTCTACAGAGAATGGTGAAGAAGAGGAAGATGAACAGTCAGAATGTCAAACTTCTGTTGGTACATTATTAGCTAAAATGAAGACCTGTGTCGATACCTACACCAACCGCCTAAGATCTAAAAGGGAAAATGTGAAAGCCGGAGTCAAGCCGGACGCGCCTGATCAAGAGCCCGAAGGACTTGCGCTTCTGGTCCCCGACATCCAGAGGACTGCTGAGATCGTCCACGCCGCCACCGCCAATCTGCGGCAAGCCAATCAAGTTCTGGACATGGCAAGACATGTGCCACTCTATCGTGCTCTGCTAGAGTTGCTCCGCGCCATTGCTTCTTGCACATCTATGGTGCCGCTGTTGTTGCCTCTTTCTACAGAGAATGGTGAAGAAGAGGAAGATGAACAGTCAGAATGTCAAACTTCTGTTGGTACATTATTAGCTAAAATGAAGACCTGTGTCGATACCTACACCAACCGCCTAAGATCTAAAAGGGAAAATGTGAAAGCCGGAGTCAAGCCGGACGCGCCTGATCAAGAGCCCGAAGGACTTGCGCTTCTGGTCCCCGACATCCAGAGGACTGCTGAGATCGTCCACGCCGCCACCGCCAATCTGCGGCAAGCCAATCAA

Peptide sequence:

MARHVPLYRALLELLRAIASCTSMVPLLLPLSTENGEEEEDEQSECQTSVGTLLAKMKTCVDTYTNRLRSKRENVKAGVKPDAPDQEPEGLALLVPDIQRTAEIVHAATANLRQANQVLDMARHVPLYRALLELLRAIASCTSMVPLLLPLSTENGEEEEDEQSECQTSVGTLLAKMKTCVDTYTNRLRSKRENVKAGVKPDAPDQEPEGLALLVPDIQRTAEIVHAATANLRQANQ

IRESfinder result

IRESfinder score

0.24327243

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page