top of page

mmu_circAsxl2_511

Basic information of circular RNA
PanCircBase ID:

mmu_circAsxl2_511

mm39_Chr. Position ID:

chr12|3526025|3543839|+

Gene name:

Asxl2

Transcript:

ENSMUST00000144247.9

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

4

Exon/intron indexes:

8,9,10,11

Exon/intron offsets:

0,8419,13611,17708

Genomic length:

17814

Exon/intron sizes in nt:

144,164,97,106

Flanking exon/introns:

chr12:3524613-3526025|chr12:3543839-3546224

Splice length:

511

Other database IDs:

CIRCpedia: HSA_CIRCpedia_91493

Human Ortholog IDs:
Mature spliced Sequence:

CCCTATGGGAAGGAAAGCAATCTGATGGACAGTCAAGCAGTCCCCAGAACTCAAATTCCAGCTTTTCTTCCTCAGTGAAAGTGGAAAGTTCTCTGCTAGGCTTGGGGAAGAAGTCTTTCCAGAGGTCTGACAGACTCCACACAAGACAGATGAAAAGGACTAAATGTGCTGACATTGATGTTGAGACTCCTGATTCCATTCTGGTTAATACTAATCTTCGAGCACTGATCAACAAGCACACCTTTTCAGTTCTTCCTGGAGACTGCCAGCAGCGCCTGCTTTTGTTGCTTCCAGAGGTGGATCGACAGGTTGGTCCAGATGGCCTGATGAAGTTGAATGGCTCAGCCCTTAACAATGAGTTCTTCACTTCTGCAGCCCAGGGCTGGAAGGAAAGGCTCTCAGAAGGTGAATTTACTCCTGAAATGCAGGTGAGAATTCGACAAGAGATTGAGAAGGAGAAGAAAGTAGAGCTGTGGAAGGAACAATTCTTTGAAAATTACTATGGTCAGAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGCAGGTGAGAATTCGACAAGA

59.96

TGAGTTCTGGGGACTGCTTG

59.6

141

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCAGGTGAGAATTCGACAAGA

59.96

GAGTTCTGGGGACTGCTTGA

59.31

140

PCR template sequence:

TTACTCCTGAAATGCAGGTGAGAATTCGACAAGAGATTGAGAAGGAGAAGAAAGTAGAGCTGTGGAAGGAACAATTCTTTGAAAATTACTATGGTCAGAGCCCTATGGGAAGGAAAGCAATCTGATGGACAGTCAAGCAGTCCCCAGAACTCAAATTCCAGCTTTTCTTCCTCAGTGAAAGTGGAAAGTTCTCTGCTAGG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-320-3p(1), mmu-miR-3065-5p(1)

siRNAs for circular RNA silencing
Junction sequence

ACTATGGTCAGAGCCCTATGGGAAGG

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCASXL2_511_ORF_1

0.8006

0.177348943

0.666452947

519

ORF sequence:

ATGGTCAGAGCCCTATGGGAAGGAAAGCAATCTGATGGACAGTCAAGCAGTCCCCAGAACTCAAATTCCAGCTTTTCTTCCTCAGTGAAAGTGGAAAGTTCTCTGCTAGGCTTGGGGAAGAAGTCTTTCCAGAGGTCTGACAGACTCCACACAAGACAGATGAAAAGGACTAAATGTGCTGACATTGATGTTGAGACTCCTGATTCCATTCTGGTTAATACTAATCTTCGAGCACTGATCAACAAGCACACCTTTTCAGTTCTTCCTGGAGACTGCCAGCAGCGCCTGCTTTTGTTGCTTCCAGAGGTGGATCGACAGGTTGGTCCAGATGGCCTGATGAAGTTGAATGGCTCAGCCCTTAACAATGAGTTCTTCACTTCTGCAGCCCAGGGCTGGAAGGAAAGGCTCTCAGAAGGTGAATTTACTCCTGAAATGCAGGTGAGAATTCGACAAGAGATTGAGAAGGAGAAGAAAGTAGAGCTGTGGAAGGAACAATTCTTTGAAAATTACTATGGTCAG

Peptide sequence:

MVRALWEGKQSDGQSSSPQNSNSSFSSSVKVESSLLGLGKKSFQRSDRLHTRQMKRTKCADIDVETPDSILVNTNLRALINKHTFSVLPGDCQQRLLLLLPEVDRQVGPDGLMKLNGSALNNEFFTSAAQGWKERLSEGEFTPEMQVRIRQEIEKEKKVELWKEQFFENYYGQ

IRESfinder result

IRESfinder score

0.610823586

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page