top of page

mmu_circAsxl2_497

Basic information of circular RNA
PanCircBase ID:

mmu_circAsxl2_497

mm39_Chr. Position ID:

chr12|3501661|3524613|+

Gene name:

Asxl2

Transcript:

ENSMUST00000111215.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

4

Exon/intron indexes:

4,5,6,7

Exon/intron offsets:

0,5400,17816,22828

Genomic length:

22952

Exon/intron sizes in nt:

109,148,116,124

Flanking exon/introns:

chr12:3500253-3501661|chr12:3524613-3534444

Splice length:

497

Other database IDs:

CIRCpedia: MMU_CIRCpedia_17368, circAtlas: mmu-Asxl2_0013

Human Ortholog IDs:
Mature spliced Sequence:

TGGGACTTCCCCTCTTGCATGCTTGAATGCAATGCTGCACACAAACTCCCGAGGAGAAGAAGGCATCTTCTATAAAGTTCCAGGTAGAATGGGCGTGTATACTTTGAAGAAAGATGTGCCAGATGGAGTGAAAGAGCTGTCAGAAGGTTCAGAAGAAAGCAGTGATGGTCAGTCAGATTCTCAGAGCTCTGAGAACAGCAGCAGCAGTGATGGTGGCAGCAACAAAGAAGGGAGAAAGAGCAGGTGGAAAAGGAAAGTATCATCTAGACTGTCACATCCACCCTCTCCCCCGTCAGGCTGCCCATCACCCACCATTCCAGCAAGTAAAGTCATTTCTCCATCACAGAAGCACAGCAAAAAGGCATTAAAACAGGCCTTGAAGCAGCAACAACAGAAGAAGAAGCAGCAGCAATGCAGACCAAGCATGTCCATCTCCAATCAACACCTCTCTCTCAAGACTGTCAAAGCAGCCAGTGACTCTGTACCTGCCAAACCTG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGCAGACCAAGCATGTCCAT

59.96

GATGCCTTCTTCTCCTCGGG

59.89

152

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CAGCAGCAATGCAGACCAAG

60.11

GATGCCTTCTTCTCCTCGGG

59.89

161

PCR template sequence:

AAGAAGCAGCAGCAATGCAGACCAAGCATGTCCATCTCCAATCAACACCTCTCTCTCAAGACTGTCAAAGCAGCCAGTGACTCTGTACCTGCCAAACCTGTGGGACTTCCCCTCTTGCATGCTTGAATGCAATGCTGCACACAAACTCCCGAGGAGAAGAAGGCATCTTCTATAAAGTTCCAGGTAGAATGGGCGTGTAT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

5

Interacting miRNAs (#binding sites)

mmu-miR-103-3p(1), mmu-miR-33-5p(1), mmu-miR-107-3p(1), mmu-miR-300-3p(1), mmu-miR-539-5p(1)

siRNAs for circular RNA silencing
Junction sequence

CCTGCCAAACCTGTGGGACTTCCCCT

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCASXL2_497_ORF_1

0.4608

0.121817964

0.410722971

492

ORF sequence:

ATGCTGCACACAAACTCCCGAGGAGAAGAAGGCATCTTCTATAAAGTTCCAGGTAGAATGGGCGTGTATACTTTGAAGAAAGATGTGCCAGATGGAGTGAAAGAGCTGTCAGAAGGTTCAGAAGAAAGCAGTGATGGTCAGTCAGATTCTCAGAGCTCTGAGAACAGCAGCAGCAGTGATGGTGGCAGCAACAAAGAAGGGAGAAAGAGCAGGTGGAAAAGGAAAGTATCATCTAGACTGTCACATCCACCCTCTCCCCCGTCAGGCTGCCCATCACCCACCATTCCAGCAAGTAAAGTCATTTCTCCATCACAGAAGCACAGCAAAAAGGCATTAAAACAGGCCTTGAAGCAGCAACAACAGAAGAAGAAGCAGCAGCAATGCAGACCAAGCATGTCCATCTCCAATCAACACCTCTCTCTCAAGACTGTCAAAGCAGCCAGTGACTCTGTACCTGCCAAACCTGTGGGACTTCCCCTCTTGCATGCTTGA

Peptide sequence:

MLHTNSRGEEGIFYKVPGRMGVYTLKKDVPDGVKELSEGSEESSDGQSDSQSSENSSSSDGGSNKEGRKSRWKRKVSSRLSHPPSPPSGCPSPTIPASKVISPSQKHSKKALKQALKQQQQKKKQQQCRPSMSISNQHLSLKTVKAASDSVPAKPVGLPLLHA

IRESfinder result

IRESfinder score

0.571557439

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page