top of page

mmu_circAscc3_283

Basic information of circular RNA
PanCircBase ID:

mmu_circAscc3_283

mm39_Chr. Position ID:

chr10|50480846|50484166|+

Gene name:

Ascc3

Transcript:

ENSMUST00000035606.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

2,3

Exon/intron offsets:

0,3169

Genomic length:

3320

Exon/intron sizes in nt:

132,151

Flanking exon/introns:

chr10:50468993-50480846|chr10:50484166-50493807

Splice length:

283

Other database IDs:

CIRCpedia: MMU_CIRCpedia_21882, circAtlas: mmu-Ascc3_0047

circAtlas: hsa-ASCC3_0038, CIRCpedia: HSA_CIRCpedia_146758

Human Ortholog IDs:
Mature spliced Sequence:

TTTCGAGTTTCTTATTTCTATGGATCACTGACTGAGTTATAAATGGCTCTACCTCGGCTCACAGGAGCCTTGCGCTCCTTTTCAAATGTCACCAAGCAAGATAATTACAATGAAGAAGTAGCTGACTTGAAGTTGAAGCGATCTAAACTTCATGAACAAGTTTTAGATTTTGGCCTTACATGGAAGAAGATAGTGAAATTTTTGAATGAAAAGCTAGAGAAGAATAAAATGCAAAATATAAATGAAGACTTAAAAGACATACTACAAGCTGCAAAACAAATCG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGAAAAGCTAGAGAAGAATAAAATGCA

57.99

TTTGAAAAGGAGCGCAAGGC

59.97

163

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGAAAAGCTAGAGAAGAATAAAATGCA

57.99

TCCTGTGAGCCGAGGTAGAG

60.39

143

PCR template sequence:

AAGAAGATAGTGAAATTTTTGAATGAAAAGCTAGAGAAGAATAAAATGCAAAATATAAATGAAGACTTAAAAGACATACTACAAGCTGCAAAACAAATCGTTTCGAGTTTCTTATTTCTATGGATCACTGACTGAGTTATAAATGGCTCTACCTCGGCTCACAGGAGCCTTGCGCTCCTTTTCAAATGTCACCAAGCAAG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-let-7a-5p(1), mmu-let-7e-5p(1)

siRNAs for circular RNA silencing
Junction sequence

GCAAAACAAATCGTTTCGAGTTTCTT

siRNA sets

GAAACTCGAAACGATTTGT, AAACTCGAAACGATTTGTT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCASCC3_283_ORF_1

0.7253

-0.014430044

0.121868192

276

ORF sequence:

ATGGCTCTACCTCGGCTCACAGGAGCCTTGCGCTCCTTTTCAAATGTCACCAAGCAAGATAATTACAATGAAGAAGTAGCTGACTTGAAGTTGAAGCGATCTAAACTTCATGAACAAGTTTTAGATTTTGGCCTTACATGGAAGAAGATAGTGAAATTTTTGAATGAAAAGCTAGAGAAGAATAAAATGCAAAATATAAATGAAGACTTAAAAGACATACTACAAGCTGCAAAACAAATCGTTTCGAGTTTCTTATTTCTATGGATCACTGACTGA

Peptide sequence:

MALPRLTGALRSFSNVTKQDNYNEEVADLKLKRSKLHEQVLDFGLTWKKIVKFLNEKLEKNKMQNINEDLKDILQAAKQIVSSFLFLWITD

IRESfinder result

IRESfinder score

0.629573377

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page