top of page

mmu_circArnt_597

Basic information of circular RNA
PanCircBase ID:

mmu_circArnt_597

mm39_Chr. Position ID:

chr3|95377487|95387571|+

Gene name:

Arnt

Transcript:

ENSMUST00000147765.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

4

Exon/intron indexes:

6,7,8,9

Exon/intron offsets:

0,4362,5903,10018

Genomic length:

10084

Exon/intron sizes in nt:

214,214,103,66

Flanking exon/introns:

chr3:95374148-95377487|chr3:95387571-95388064

Splice length:

597

Other database IDs:

CIRCpedia: HSA_CIRCpedia_109351

Human Ortholog IDs:
Mature spliced Sequence:

GGAAAATCATAGTGAAATAGAACGGCGGCGACGGAACAAGATGACAGCTTACATCACAGAACTGTCAGACATGGTACCTACATGTAGTGCCCTGGCTCGAAAACCAGACAAGCTAACCATCTTACGCATGGCCGTTTCTCACATGAAGTCCTTGAGGGGAACTGGCAACACATCTACTGATGGCTCCTACAAGCCATCTTTCCTCACTGATCAGGAACTGAAACATTTGATCTTGGAGGCAGCAGATGGCTTTCTGTTTATTGTCTCCTGTGAGACTGGACGGGTGGTGTATGTCTCTGACTCAGTGACTCCCGTTTTGAACCAGCCACAGTCTGAATGGTTCGGGAGCACACTGTATGATCAGGTGCACCCAGATGATGTGGATAAACTTCGAGAGCAGCTCTCTACATCAGAAAATGCCCTAACAGGGCGGGTCCTGGATCTGAAGACTGGAACAGTGAAAAAGGAAGGCCAGCAGTCTTCCATGAGGATGTGCATGGGCTCACGAAGGTCGTTCATCTGCCGCATGAGGTGTGGTACTAGCTCCGTGGACCCTGTTTCCATGAATAGACTGAGCTTTTTGAGGAACAGATGCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGTGGTACTAGCTCCGTGGA

59.96

GCCAGGGCACTACATGTAGG

60.18

161

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

AGGTGTGGTACTAGCTCCGT

59.96

GCCAGGGCACTACATGTAGG

60.18

164

PCR template sequence:

TGGGCTCACGAAGGTCGTTCATCTGCCGCATGAGGTGTGGTACTAGCTCCGTGGACCCTGTTTCCATGAATAGACTGAGCTTTTTGAGGAACAGATGCAGGGAAAATCATAGTGAAATAGAACGGCGGCGACGGAACAAGATGACAGCTTACATCACAGAACTGTCAGACATGGTACCTACATGTAGTGCCCTGGCTCGA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

5

Interacting miRNAs (#binding sites)

mmu-miR-7b-5p(1), mmu-miR-7a-5p(1), mmu-miR-222-3p(1), mmu-miR-1198-5p(1), mmu-miR-452-3p(1)

siRNAs for circular RNA silencing
Junction sequence

GGAACAGATGCAGGGAAAATCATAGT

siRNA sets

TTTTCCCTGCATCTGTTCC, TATGATTTTCCCTGCATCT, ATGATTTTCCCTGCATCTG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCARNT_597_ORF_1

0.7312

0.222048176

0.995081358

1152

ORF sequence:

ATGACAGCTTACATCACAGAACTGTCAGACATGGTACCTACATGTAGTGCCCTGGCTCGAAAACCAGACAAGCTAACCATCTTACGCATGGCCGTTTCTCACATGAAGTCCTTGAGGGGAACTGGCAACACATCTACTGATGGCTCCTACAAGCCATCTTTCCTCACTGATCAGGAACTGAAACATTTGATCTTGGAGGCAGCAGATGGCTTTCTGTTTATTGTCTCCTGTGAGACTGGACGGGTGGTGTATGTCTCTGACTCAGTGACTCCCGTTTTGAACCAGCCACAGTCTGAATGGTTCGGGAGCACACTGTATGATCAGGTGCACCCAGATGATGTGGATAAACTTCGAGAGCAGCTCTCTACATCAGAAAATGCCCTAACAGGGCGGGTCCTGGATCTGAAGACTGGAACAGTGAAAAAGGAAGGCCAGCAGTCTTCCATGAGGATGTGCATGGGCTCACGAAGGTCGTTCATCTGCCGCATGAGGTGTGGTACTAGCTCCGTGGACCCTGTTTCCATGAATAGACTGAGCTTTTTGAGGAACAGATGCAGGGAAAATCATAGTGAAATAGAACGGCGGCGACGGAACAAGATGACAGCTTACATCACAGAACTGTCAGACATGGTACCTACATGTAGTGCCCTGGCTCGAAAACCAGACAAGCTAACCATCTTACGCATGGCCGTTTCTCACATGAAGTCCTTGAGGGGAACTGGCAACACATCTACTGATGGCTCCTACAAGCCATCTTTCCTCACTGATCAGGAACTGAAACATTTGATCTTGGAGGCAGCAGATGGCTTTCTGTTTATTGTCTCCTGTGAGACTGGACGGGTGGTGTATGTCTCTGACTCAGTGACTCCCGTTTTGAACCAGCCACAGTCTGAATGGTTCGGGAGCACACTGTATGATCAGGTGCACCCAGATGATGTGGATAAACTTCGAGAGCAGCTCTCTACATCAGAAAATGCCCTAACAGGGCGGGTCCTGGATCTGAAGACTGGAACAGTGAAAAAGGAAGGCCAGCAGTCTTCCATGAGGATGTGCATGGGCTCACGAAGGTCGTTCATCTGCCGCATGAGGTGTGGTACTAGCTCCGTGGACCCTGTTTCCATGAATAGACTGAGCTTTTTGAGGAACAGATGC

Peptide sequence:

MTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRC

IRESfinder result

IRESfinder score

0.453232833

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page