top of page

mmu_circArmh3_634

Basic information of circular RNA
PanCircBase ID:

mmu_circArmh3_634

mm39_Chr. Position ID:

chr19|45939100|45954773|-

Gene name:

Armh3

Transcript:

ENSMUST00000045396.9

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

9

Exon/intron indexes:

14,13,12,11,10,9,8,7,6

Exon/intron offsets:

0,1963,2762,6018,7745,9651,14502,14700,15580

Genomic length:

15673

Exon/intron sizes in nt:

94,76,47,61,44,57,87,75,93

Flanking exon/introns:

chr19:45934542-45939100|chr19:45954773-45961261

Splice length:

634

Other database IDs:

CIRCpedia: MMU_CIRCpedia_215199, circAtlas: mmu-9130011E15Rik_0043

circAtlas: hsa-SCAF8_0001

Human Ortholog IDs:
Mature spliced Sequence:

AACTTGATGGAGAGTTTGGATTCATTACTTTGTGCAGAAGGTTCTGAAAGTCTGAAGAGTTTATGTCTGAAACTTCTTCTTTGCTTGGTGACTGTCACAGATAATATCAGCCAGAACACTATCCTGGAATATGTAATGATCAACAGTATATTCGAAGCAATTTTACAGATACTGTCCCATCCCCCAAGTCGTAGAGAGCATGGGTATGATGCTGTCGTCCTCTTGGCTTTACTGGTAAATTACAGAAAATATGAGTCTGTGAATCCTTACATTGTGAAGCTGTCTATTGTGGACGACGAGGCTACACTGAATGGAATGGGGCTTGTGATCACTCAGGCTTTATCTGAGTACAACAGGCAGTATAAAGACAAGGAAGAAGAACATCAGAGTGGGTTTTTTTCTGCTTTAACAAATATGGTGGGCAGCATGTTCATAGCAGACGCCCATGAGAAACTCTCAGTACAAACCAATGAAGCCATTCTTCTGGCACTCTATGAAGCTGTCCATTTAAATCGAAACTTCATCACAGTTTTAGCTCAGAGCCATCCAGAAATGGGGTTGGTGACAGCCCCTGCCAGCCCTACTCCTACAACCCCAGCCACACCCCTTGGGACTACACCGCCCTCCTCTGACG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TACTCCTACAACCCCAGCCA

59.88

CTGTGACAGTCACCAAGCAA

58.33

153

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GCCAGCCCTACTCCTACAAC

59.82

CTGTGACAGTCACCAAGCAA

58.33

161

PCR template sequence:

GCTCAGAGCCATCCAGAAATGGGGTTGGTGACAGCCCCTGCCAGCCCTACTCCTACAACCCCAGCCACACCCCTTGGGACTACACCGCCCTCCTCTGACGAACTTGATGGAGAGTTTGGATTCATTACTTTGTGCAGAAGGTTCTGAAAGTCTGAAGAGTTTATGTCTGAAACTTCTTCTTTGCTTGGTGACTGTCACAG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-135a-5p(1), mmu-miR-298-5p(1), mmu-miR-3087-3p(1)

siRNAs for circular RNA silencing
Junction sequence

CCCTCCTCTGACGAACTTGATGGAGA

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCARMH3_634_ORF_1

0.8754

0.087894654

0.829990339

675

ORF sequence:

ATGGAGAGTTTGGATTCATTACTTTGTGCAGAAGGTTCTGAAAGTCTGAAGAGTTTATGTCTGAAACTTCTTCTTTGCTTGGTGACTGTCACAGATAATATCAGCCAGAACACTATCCTGGAATATGTAATGATCAACAGTATATTCGAAGCAATTTTACAGATACTGTCCCATCCCCCAAGTCGTAGAGAGCATGGGTATGATGCTGTCGTCCTCTTGGCTTTACTGGTAAATTACAGAAAATATGAGTCTGTGAATCCTTACATTGTGAAGCTGTCTATTGTGGACGACGAGGCTACACTGAATGGAATGGGGCTTGTGATCACTCAGGCTTTATCTGAGTACAACAGGCAGTATAAAGACAAGGAAGAAGAACATCAGAGTGGGTTTTTTTCTGCTTTAACAAATATGGTGGGCAGCATGTTCATAGCAGACGCCCATGAGAAACTCTCAGTACAAACCAATGAAGCCATTCTTCTGGCACTCTATGAAGCTGTCCATTTAAATCGAAACTTCATCACAGTTTTAGCTCAGAGCCATCCAGAAATGGGGTTGGTGACAGCCCCTGCCAGCCCTACTCCTACAACCCCAGCCACACCCCTTGGGACTACACCGCCCTCCTCTGACGAACTTGATGGAGAGTTTGGATTCATTACTTTGTGCAGAAGGTTCTGA

Peptide sequence:

MESLDSLLCAEGSESLKSLCLKLLLCLVTVTDNISQNTILEYVMINSIFEAILQILSHPPSRREHGYDAVVLLALLVNYRKYESVNPYIVKLSIVDDEATLNGMGLVITQALSEYNRQYKDKEEEHQSGFFSALTNMVGSMFIADAHEKLSVQTNEAILLALYEAVHLNRNFITVLAQSHPEMGLVTAPASPTPTTPATPLGTTPPSSDELDGEFGFITLCRRF

IRESfinder result

IRESfinder score

0.729091521

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page