top of page

mmu_circArhgap26_688

Basic information of circular RNA
PanCircBase ID:

mmu_circArhgap26_688

mm39_Chr. Position ID:

chr18|39253171|39363018|+

Gene name:

Arhgap26

Transcript:

ENSMUST00000097593.9

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

8

Exon/intron indexes:

7,8,9,10,11,12,13,14

Exon/intron offsets:

0,1655,6714,11937,29921,85165,107249,109772

Genomic length:

109847

Exon/intron sizes in nt:

105,130,101,95,79,37,66,75

Flanking exon/introns:

chr18:39244953-39253171|chr18:39363018-39376658

Splice length:

688

Other database IDs:

CIRCpedia: MMU_CIRCpedia_19059, circAtlas: mmu-Arhgap26_0041

circAtlas: hsa-ARHGAP26_0059

Human Ortholog IDs:
Mature spliced Sequence:

CTGCTGGCCTTCCTGCAAGGACTCTTCACTTTCTATCACCATGGTTATGAGCTGGCCAAGGATTTTGGTGACTTTAAGACACAGTTGACCATCAGCATACAAAATACAAGAAACCGCTTTGAAGGAACCAGGTCTGAGGTGGAATCGCTGATGAAGAAGATGAAGGAAAACCCCCTGGAGCACAAGACCATCAGCCCGTACACCATGGAAGGGTACCTGTACGTGCAGGAGAAGCGTCACTTTGGAACTTCCTGGGTGAAGCACTACTGTACCTACCAACGGGATTCCAAACAAATCACCATGGTTCCATTCGACCAAAAGTCAGGAGGAAAGGGGGGAGAAGACGAGTCCGTTACCCTCAAATCCTGCACACGGCGAAAGACAGACTCCATCGAGAAGCGATTCTGCTTTGACGTGGAAGCAGTAGACAGGCCAGGGGTTATCACCATGCAGGCGTTGTCGGAAGAGGACCGTAGGCTCTGGATGGAAGCCATGGATGGCCGGGAACCTGTGTACAACTCCAACAGAGACAGCCAGAGCGAAGGGACCGCACAATTGGACAGTATCGGCTTCAGCATAATAAGGAAATGCATCCATGCGGTGGAGACCAGAGGGATCAATGAGCAGGGGCTCTACCGAATCGTGGGGGTCAACTCCAGGGTGCAGAAGTTGCTGAGCGTCCTGATGG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GAGGGATCAATGAGCAGGGG

59.89

CACCAAAATCCTTGGCCAGC

60.04

148

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GAGGGATCAATGAGCAGGGG

59.89

ACCAAAATCCTTGGCCAGCT

60.18

147

PCR template sequence:

TGCATCCATGCGGTGGAGACCAGAGGGATCAATGAGCAGGGGCTCTACCGAATCGTGGGGGTCAACTCCAGGGTGCAGAAGTTGCTGAGCGTCCTGATGGCTGCTGGCCTTCCTGCAAGGACTCTTCACTTTCTATCACCATGGTTATGAGCTGGCCAAGGATTTTGGTGACTTTAAGACACAGTTGACCATCAGCATAC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

6

Interacting miRNAs (#binding sites)

mmu-miR-207(2), mmu-miR-29b-1-5p(1), mmu-miR-199b-3p(1), mmu-miR-199a-3p(1), mmu-miR-224-5p(1), mmu-miR-5101(1)

siRNAs for circular RNA silencing
Junction sequence

AGCGTCCTGATGGCTGCTGGCCTTCC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCARHGAP26_688_ORF_1

1.0851

0.364768858

0.922528174

588

ORF sequence:

ATGAAGAAGATGAAGGAAAACCCCCTGGAGCACAAGACCATCAGCCCGTACACCATGGAAGGGTACCTGTACGTGCAGGAGAAGCGTCACTTTGGAACTTCCTGGGTGAAGCACTACTGTACCTACCAACGGGATTCCAAACAAATCACCATGGTTCCATTCGACCAAAAGTCAGGAGGAAAGGGGGGAGAAGACGAGTCCGTTACCCTCAAATCCTGCACACGGCGAAAGACAGACTCCATCGAGAAGCGATTCTGCTTTGACGTGGAAGCAGTAGACAGGCCAGGGGTTATCACCATGCAGGCGTTGTCGGAAGAGGACCGTAGGCTCTGGATGGAAGCCATGGATGGCCGGGAACCTGTGTACAACTCCAACAGAGACAGCCAGAGCGAAGGGACCGCACAATTGGACAGTATCGGCTTCAGCATAATAAGGAAATGCATCCATGCGGTGGAGACCAGAGGGATCAATGAGCAGGGGCTCTACCGAATCGTGGGGGTCAACTCCAGGGTGCAGAAGTTGCTGAGCGTCCTGATGGCTGCTGGCCTTCCTGCAAGGACTCTTCACTTTCTATCACCATGGTTATGA

Peptide sequence:

MKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLWMEAMDGREPVYNSNRDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRVQKLLSVLMAAGLPARTLHFLSPWL

IRESfinder result

IRESfinder score

0.330633547

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page