top of page

mmu_circAnkrd17_764

Basic information of circular RNA
PanCircBase ID:

mmu_circAnkrd17_764

mm39_Chr. Position ID:

chr5|90412485|90426250|-

Gene name:

Ankrd17

Transcript:

ENSMUST00000014421.15

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

5

Exon/intron indexes:

20,19,18,17,16

Exon/intron offsets:

0,804,3705,4011,13616

Genomic length:

13765

Exon/intron sizes in nt:

21,41,43,14,61,12,149

Flanking exon/introns:

chr5:90412025-90412485|chr5:90426250-90430709

Splice length:

764

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

CAGTCAGTGGAAGAGCATCTGCAATGTCAAACACTCCTACCCACAGTATCGCTGCTTCTGTTTCCCAACCTCAGACTCCAACTCCAAGTCCCATCATCTCTCCTTCAGCCATGCTACCTATCTACCCTGCCATTGATATTGATGCACAGACTGAGAGTAATCATGATACTGCACTAACACTTGCCTGTGCTGGTGGCCATGAGGAACTGGTACAAACACTACTAGAGAGAGGAGCTAGTATTGAACATCGAGACAAGAAAGGTTTTACTCCACTCATCTTGGCTGCTACAGCTGGTCATGTTGGTGTTGTAGAGATATTGCTGGACAATGGTGCAGACATTGAAGCCCAGTCAGAAAGAACCAAGGACACACCACTGTCCTTGGCTTGTTCTGGGGGCAGGCAGGAGGTGGTGGAGTTGTTGTTAGCTCGCGGTGCAAATAAAGAACACAGGAATGTTTCTGATTATACACCTCTAAGCCTGGCTGCTTCTGGTGGCTATGTGAACATCATCAAAATACTGCTAAATGCAGGAGCTGAGATCAATTCAAGAACTGGCAGCAAATTGGGCATTTCTCCACTGATGTTGGCAGCTATGAATGGGCATACAGCTGCAGTTAAGCTCCTTTTAGACATGGGCTCTGACATAAATGCTCAGATAGAAACCAATCGGAACACTGCCCTTACATTAGCCTGCTTCCAAGGAAGAACTGAAGTGGTTAGCCTTCTGCTTGATCGAAAAGCAAATGTTGAACATAGGGCTAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGCCCTTACATTAGCCTGCT

59.08

TGGGAAACAGAAGCAGCGAT

59.96

155

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCCCTTACATTAGCCTGCT

59.08

GTTGGGAAACAGAAGCAGCG

60.04

157

PCR template sequence:

CAATCGGAACACTGCCCTTACATTAGCCTGCTTCCAAGGAAGAACTGAAGTGGTTAGCCTTCTGCTTGATCGAAAAGCAAATGTTGAACATAGGGCTAAGCAGTCAGTGGAAGAGCATCTGCAATGTCAAACACTCCTACCCACAGTATCGCTGCTTCTGTTTCCCAACCTCAGACTCCAACTCCAAGTCCCATCATCTC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

7

Interacting miRNAs (#binding sites)

mmu-miR-34a-5p(1), mmu-miR-122-5p(1), mmu-miR-181b-5p(1), mmu-miR-433-3p(1), mmu-miR-22-3p(1), mmu-miR-27a-5p(1), mmu-miR-5101(1)

siRNAs for circular RNA silencing
Junction sequence

ACATAGGGCTAAGCAGTCAGTGGAAG

siRNA sets

CTTCCACTGACTGCTTAGC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANKRD17_764_ORF_1

1.0125

0.047645994

0.968429873

918

ORF sequence:

ATGTCAAACACTCCTACCCACAGTATCGCTGCTTCTGTTTCCCAACCTCAGACTCCAACTCCAAGTCCCATCATCTCTCCTTCAGCCATGCTACCTATCTACCCTGCCATTGATATTGATGCACAGACTGAGAGTAATCATGATACTGCACTAACACTTGCCTGTGCTGGTGGCCATGAGGAACTGGTACAAACACTACTAGAGAGAGGAGCTAGTATTGAACATCGAGACAAGAAAGGTTTTACTCCACTCATCTTGGCTGCTACAGCTGGTCATGTTGGTGTTGTAGAGATATTGCTGGACAATGGTGCAGACATTGAAGCCCAGTCAGAAAGAACCAAGGACACACCACTGTCCTTGGCTTGTTCTGGGGGCAGGCAGGAGGTGGTGGAGTTGTTGTTAGCTCGCGGTGCAAATAAAGAACACAGGAATGTTTCTGATTATACACCTCTAAGCCTGGCTGCTTCTGGTGGCTATGTGAACATCATCAAAATACTGCTAAATGCAGGAGCTGAGATCAATTCAAGAACTGGCAGCAAATTGGGCATTTCTCCACTGATGTTGGCAGCTATGAATGGGCATACAGCTGCAGTTAAGCTCCTTTTAGACATGGGCTCTGACATAAATGCTCAGATAGAAACCAATCGGAACACTGCCCTTACATTAGCCTGCTTCCAAGGAAGAACTGAAGTGGTTAGCCTTCTGCTTGATCGAAAAGCAAATGTTGAACATAGGGCTAAGCAGTCAGTGGAAGAGCATCTGCAATGTCAAACACTCCTACCCACAGTATCGCTGCTTCTGTTTCCCAACCTCAGACTCCAACTCCAAGTCCCATCATCTCTCCTTCAGCCATGCTACCTATCTACCCTGCCATTGATATTGATGCACAGACTGAGAGTAATCATGATACTGCACTAA

Peptide sequence:

MSNTPTHSIAASVSQPQTPTPSPIISPSAMLPIYPAIDIDAQTESNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANVEHRAKQSVEEHLQCQTLLPTVSLLLFPNLRLQLQVPSSLLQPCYLSTLPLILMHRLRVIMILH

IRESfinder result

IRESfinder score

0.610428848

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page