top of page

mmu_circAkt3_132

Basic information of circular RNA
PanCircBase ID:

mmu_circAkt3_132

mm39_Chr. Position ID:

chr1|176924532|176924664|-

Gene name:

Akt3

Transcript:

ENSMUST00000019843.15

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

1

Exon/intron indexes:

5

Exon/intron offsets:

0

Genomic length:

132

Exon/intron sizes in nt:

132

Flanking exon/introns:

chr1:176907832-176924532|chr1:176924664-176930527

Splice length:

132

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

ACGATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CGAGAGAAGGCAAGTGGAAA

57.83

CTTTCCCAAAAGTGCCTTTACCT

59.36

121

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CGAGAGAAGGCAAGTGGAAA

57.83

TTTCCCAAAAGTGCCTTTACCT

58.35

120

PCR template sequence:

CGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAGACGATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-93-5p(1), mmu-miR-20a-5p(1), mmu-miR-17-5p(1)

siRNAs for circular RNA silencing
Junction sequence

CATTATTGCAAAGACGATGAATGATT

siRNA sets

CATCGTCTTTGCAATAATG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCAKT3_132_ORF_1

1.059

0.154847534

0.317917344

261

ORF sequence:

ATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAGACGATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAG

Peptide sequence:

MNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAK

IRESfinder result

IRESfinder score

0.598781973

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page