top of page

mmu_circAdgrb3_911

Basic information of circular RNA
PanCircBase ID:

mmu_circAdgrb3_911

mm39_Chr. Position ID:

chr1|25459638|25544095|-

Gene name:

Adgrb3

Transcript:

ENSMUST00000146592.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

8

Exon/intron indexes:

14,13,12,11,10,9,8,7

Exon/intron offsets:

0,10865,11869,36434,40185,67367,83875,84355

Genomic length:

84457

Exon/intron sizes in nt:

1,03,76,15,01,09,69,19,00,00,000

Flanking exon/introns:

chr1:25435560-25459638|chr1:25544095-25570950

Splice length:

911

Other database IDs:

CIRCpedia: MMU_CIRCpedia_220552, circAtlas: mmu-Bai3_0029

circBase: hsa_circ_0076942, circAtlas: hsa-ADGRB3_0025, CIRCpedia: HSA_CIRCpedia_123068

Human Ortholog IDs:
Mature spliced Sequence:

CACCTTATGAAATATGCCCAGAGGATTATCTTATATCAATGGTGTGGAAAAGGACTCCTGCAGGCGACCTGGCATTCAATCAATGTCCACTGAATGCCACAGGCACCACTAGCAGACGCTGCTCTCTCAGTCTTCATGGAGTGGCCTCCTGGGAACAGCCGAGCTTTGCAAGATGCATATCCAATGAGTACAGACACTTGCAGCATTCAATTAAAGAGCACCTTGCGAAGGGGCAGCGGATGCTGGCAGGTGATGGAATGTCCCAGGTCACCAAGACACTATTGGATTTAACCCAGAGGAAAAATTTCTATGCAGGTGACCTTCTGGTGTCTGTGGAAATCCTGAGAAATGTGACAGACACGTTTAAAAGGGCAAGTTACATCCCTGCGTCTGATGGGGTCCAGAACTTCTTTCAAATAGTTAGCAACCTTCTTGATGAAGAAAACAAGGAGAAATGGGAAGACGCACAACAGATTTACCCAGGCTCAATAGAGTTAATGCAGGTGATTGAAGATTTTATACACATTGTTGGAATGGGGATGATGGACTTTCAAAATTCATACCTAATGACTGGAAATGTAGTGGCGAGCATTCAGAAGCTCCCTGCTGCATCTGTTCTAACCGACATCAACTTCCCCATGAAAGGCCGGAAAGGAATGGTAGACTGGGCAAGAAATTCAGAAGATCGCGTTGTGATTCCAAAAAGCATTTTCACTCCCGTGTCTTCAAAAGAATTAGATGAATCATCTGTTTTTGTTCTTGGAGCGGTCCTATACAAAAACTTAGACCTAATTTTGCCTACTTTGAGAAATTACACTGTCGTCAATTCTAAAGTCATCGTGGTCACAATCAGGCCTGAACCTAAAACAACTGACTCATTTTTGGAGATAGAGCTAGCTCACTTGGCAAAT

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GTGGTCACAATCAGGCCTGA

59.96

GATTGAATGCCAGGTCGCCT

60.75

153

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GTGGTCACAATCAGGCCTGA

59.96

TTGATTGAATGCCAGGTCGC

59.19

155

PCR template sequence:

TTACACTGTCGTCAATTCTAAAGTCATCGTGGTCACAATCAGGCCTGAACCTAAAACAACTGACTCATTTTTGGAGATAGAGCTAGCTCACTTGGCAAATCACCTTATGAAATATGCCCAGAGGATTATCTTATATCAATGGTGTGGAAAAGGACTCCTGCAGGCGACCTGGCATTCAATCAATGTCCACTGAATGCCAC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

4

Interacting miRNAs (#binding sites)

mmu-miR-23b-3p(1), mmu-miR-335-5p(1), mmu-miR-23a-3p(1), mmu-miR-338-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TCACTTGGCAAATCACCTTATGAAAT

siRNA sets

TTTCATAAGGTGATTTGCC, ATTTCATAAGGTGATTTGC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCADGRB3_911_ORF_1

0.8417

0.060772383

0.970659426

966

ORF sequence:

ATGGTGTGGAAAAGGACTCCTGCAGGCGACCTGGCATTCAATCAATGTCCACTGAATGCCACAGGCACCACTAGCAGACGCTGCTCTCTCAGTCTTCATGGAGTGGCCTCCTGGGAACAGCCGAGCTTTGCAAGATGCATATCCAATGAGTACAGACACTTGCAGCATTCAATTAAAGAGCACCTTGCGAAGGGGCAGCGGATGCTGGCAGGTGATGGAATGTCCCAGGTCACCAAGACACTATTGGATTTAACCCAGAGGAAAAATTTCTATGCAGGTGACCTTCTGGTGTCTGTGGAAATCCTGAGAAATGTGACAGACACGTTTAAAAGGGCAAGTTACATCCCTGCGTCTGATGGGGTCCAGAACTTCTTTCAAATAGTTAGCAACCTTCTTGATGAAGAAAACAAGGAGAAATGGGAAGACGCACAACAGATTTACCCAGGCTCAATAGAGTTAATGCAGGTGATTGAAGATTTTATACACATTGTTGGAATGGGGATGATGGACTTTCAAAATTCATACCTAATGACTGGAAATGTAGTGGCGAGCATTCAGAAGCTCCCTGCTGCATCTGTTCTAACCGACATCAACTTCCCCATGAAAGGCCGGAAAGGAATGGTAGACTGGGCAAGAAATTCAGAAGATCGCGTTGTGATTCCAAAAAGCATTTTCACTCCCGTGTCTTCAAAAGAATTAGATGAATCATCTGTTTTTGTTCTTGGAGCGGTCCTATACAAAAACTTAGACCTAATTTTGCCTACTTTGAGAAATTACACTGTCGTCAATTCTAAAGTCATCGTGGTCACAATCAGGCCTGAACCTAAAACAACTGACTCATTTTTGGAGATAGAGCTAGCTCACTTGGCAAATCACCTTATGAAATATGCCCAGAGGATTATCTTATATCAATGGTGTGGAAAAGGACTCCTGCAGGCGACCTGGCATTCAATCAATGTCCACTGA

Peptide sequence:

MVWKRTPAGDLAFNQCPLNATGTTSRRCSLSLHGVASWEQPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTKTLLDLTQRKNFYAGDLLVSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEKWEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNYTVVNSKVIVVTIRPEPKTTDSFLEIELAHLANHLMKYAQRIILYQWCGKGLLQATWHSINVH

IRESfinder result

IRESfinder score

0.629517321

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page