top of page

mmu_circAdgb_1243

Basic information of circular RNA
PanCircBase ID:

mmu_circAdgb_1243

mm39_Chr. Position ID:

chr10|10298409|10325873|-

Gene name:

Adgb

Transcript:

ENSMUST00000179956.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

10

Exon/intron indexes:

11,10,9,8,7,6,5,4,3,2

Exon/intron offsets:

0,3933,8405,8616,10747,13268,19819,20728,23491,27301

Genomic length:

27464

Exon/intron sizes in nt:

95,135,130,118,87,140,210,72,93,163

Flanking exon/introns:

chr10:10287632-10298409|chr10:10325873-10347984

Splice length:

1243

Other database IDs:

circAtlas: mmu-Adgb_0014

Human Ortholog IDs:
Mature spliced Sequence:

TCTCTACCATTTTGGCAGCAATGTGCCACCGGGTTCTTTTGAACAGAAGAAGGGAAAGTTCCCCATCTGGCCAGAGTGGAGCGAGGCAGACATAAATGCTGAAAAGTGGGATGCAGGCAAAGGCGGGAAGGAGAAGGACAAGACCGCCAAGAGCCCCATCTTTCACTTTTTCGAAGACCCTGAGGGAAAGATTGAATTACCACAGTCATTGAAAGTATTCTCCTGGAAACGTCCGCAAGATTTTATATTTAGCAGAACTCCTGTAGTTGTGAAAAATGAAATCACATTTGACTTATTTTCACCAAATGAACATTTACTCTGCAGTGAGCTTATGAGGTGGATCATCAGCGAAATCTATGCTGTGTGGAAGATATTCAATGGTGGGATTCTGAGCAATTACCACAAGGGGAATTTGGGGGAGCTTCCTATTCTGCCCTGGAAACCCTGGGAACACATATACTCTCTCTGCAAGGCCGTGAAGGGTCATGTGCCTTTGTTCAACAGCTACGGGAAGTATGTCGTCAAACTTTACTGGATGGGTTGTTGGAGAAAGATTACTGTGGATGACTTCCTGCCATTTGATGAGGAGAACAATCTCTTGCTTCCAGCTACATCCTATGAATTTGAACTCTGGCCAATGCTACTGTCGAAAGCTATCATTAAGCTGGCAAATGTTGACGTCCATGTAGCACACAGGAGAGAGCTAGGAGAACTCACAGTAATCCACGCTCTGACTGGGTGGTTGCCTGAAGTCATCCCTCTTCACCCAGCATATGTGGACAGAGTTTGGGAGCTCTTGAAGGAAATACTGCCTGAGTTTAAGCTCACAGAAGAGCCCAGTTCTGAAAGCAAAATCACAACGATAGACAACAAACTGAAGGAAGATGGCAAGGACGGGAAGGATGGGAAGGATGGCAAGGATGGGAAGGATGGCAAGGACAGCAAGGACTTCAAGTTGGAAGTCTCCCTTACAAACCTGAAGATTCCCGAGAAGGTCGACAGAGCTGCAAAGGAGAAAGCAGATGCAAGAGACCTTGGGAAGAAGAATAAGAAGGATGGAGAGAAGGAGAAGGAAAAATTCAAATTTTCACTCCATGGTTCGAGACCCTCATCAGATGTTCAGTACTCTATGCAGTCCTTGTCAGAGTGTTCCTCAGCAATACAGTTACCTCACATGGTCGTATATGCCACCTTTACACCACTCTATTTGTTTGAAAACAAAATCTTTTCATTAGAGAAGATG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGCCACCTTTACACCACTCT

58.86

TTATGTCTGCCTCGCTCCAC

59.82

153

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCCACCTTTACACCACTCT

58.86

TATGTCTGCCTCGCTCCACT

60.68

152

PCR template sequence:

AGAGTGTTCCTCAGCAATACAGTTACCTCACATGGTCGTATATGCCACCTTTACACCACTCTATTTGTTTGAAAACAAAATCTTTTCATTAGAGAAGATGTCTCTACCATTTTGGCAGCAATGTGCCACCGGGTTCTTTTGAACAGAAGAAGGGAAAGTTCCCCATCTGGCCAGAGTGGAGCGAGGCAGACATAAATGCT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

8

Interacting miRNAs (#binding sites)

mmu-miR-207(3), mmu-miR-137-3p(1), mmu-miR-150-5p(1), mmu-miR-217-5p(1), mmu-miR-324-5p(1), mmu-miR-1198-5p(1), mmu-miR-669d-5p(1), mmu-miR-542-5p(1)

siRNAs for circular RNA silencing
Junction sequence

ATTAGAGAAGATGTCTCTACCATTTT

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCADGB_1243_ORF_1

1.093

0.171316906

0.986825467

954

ORF sequence:

ATGAGGTGGATCATCAGCGAAATCTATGCTGTGTGGAAGATATTCAATGGTGGGATTCTGAGCAATTACCACAAGGGGAATTTGGGGGAGCTTCCTATTCTGCCCTGGAAACCCTGGGAACACATATACTCTCTCTGCAAGGCCGTGAAGGGTCATGTGCCTTTGTTCAACAGCTACGGGAAGTATGTCGTCAAACTTTACTGGATGGGTTGTTGGAGAAAGATTACTGTGGATGACTTCCTGCCATTTGATGAGGAGAACAATCTCTTGCTTCCAGCTACATCCTATGAATTTGAACTCTGGCCAATGCTACTGTCGAAAGCTATCATTAAGCTGGCAAATGTTGACGTCCATGTAGCACACAGGAGAGAGCTAGGAGAACTCACAGTAATCCACGCTCTGACTGGGTGGTTGCCTGAAGTCATCCCTCTTCACCCAGCATATGTGGACAGAGTTTGGGAGCTCTTGAAGGAAATACTGCCTGAGTTTAAGCTCACAGAAGAGCCCAGTTCTGAAAGCAAAATCACAACGATAGACAACAAACTGAAGGAAGATGGCAAGGACGGGAAGGATGGGAAGGATGGCAAGGATGGGAAGGATGGCAAGGACAGCAAGGACTTCAAGTTGGAAGTCTCCCTTACAAACCTGAAGATTCCCGAGAAGGTCGACAGAGCTGCAAAGGAGAAAGCAGATGCAAGAGACCTTGGGAAGAAGAATAAGAAGGATGGAGAGAAGGAGAAGGAAAAATTCAAATTTTCACTCCATGGTTCGAGACCCTCATCAGATGTTCAGTACTCTATGCAGTCCTTGTCAGAGTGTTCCTCAGCAATACAGTTACCTCACATGGTCGTATATGCCACCTTTACACCACTCTATTTGTTTGAAAACAAAATCTTTTCATTAGAGAAGATGTCTCTACCATTTTGGCAGCAATGTGCCACCGGGTTCTTTTGA

Peptide sequence:

MRWIISEIYAVWKIFNGGILSNYHKGNLGELPILPWKPWEHIYSLCKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLLSKAIIKLANVDVHVAHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKLTEEPSSESKITTIDNKLKEDGKDGKDGKDGKDGKDGKDSKDFKLEVSLTNLKIPEKVDRAAKEKADARDLGKKNKKDGEKEKEKFKFSLHGSRPSSDVQYSMQSLSECSSAIQLPHMVVYATFTPLYLFENKIFSLEKMSLPFWQQCATGFF

IRESfinder result

IRESfinder score

0.573736724

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page