top of page

mmu_circAdam17_345

Basic information of circular RNA
PanCircBase ID:

mmu_circAdam17_345

mm39_Chr. Position ID:

chr12|21379054|21382211|-

Gene name:

Adam17

Transcript:

ENSMUST00000101551.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

17,16,15

Exon/intron offsets:

0,979,3022

Genomic length:

3157

Exon/intron sizes in nt:

79,131,135

Flanking exon/introns:

chr12:21378134-21379054|chr12:21382211-21382570

Splice length:

345

Other database IDs:

CIRCpedia: MMU_CIRCpedia_13208, circAtlas: mmu-Adam17_0001

circAtlas: hsa-ADAM17_0006

Human Ortholog IDs:
Mature spliced Sequence:

GGAATAGCAGTGAGTGCCCCCCACCCGGAGATGCTGAAGATGACACTGTGTGCTTGGACCTTGGCAAGTGCAAGGCTGGGAAATGCATCCCTTTCTGCAAGAGGGAGCAGGAGCTGGAGTCCTGCGCATGCGTTGACACTGACAACTCGTGCAAGGTGTGCTGCAGGAACCTTTCTGGCCCGTGTGTGCCGTACGTCGATGCAGAGCAAAAGAACTTGTTTTTGAGGAAAGGGAAGCCATGTACAGTAGGGTTTTGCGACATGAATGGCAAATGTGAGAAACGAGTACAGGACGTAATTGAGCGATTTTGGGATTTCATTGACCAGCTGAGCATCAACACTTTTG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GGTTTTGCGACATGAATGGCA

60.34

AGGTCCAAGCACACAGTGTC

60.18

157

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GGTTTTGCGACATGAATGGC

58.65

AGGTCCAAGCACACAGTGTC

60.18

157

PCR template sequence:

GTAGGGTTTTGCGACATGAATGGCAAATGTGAGAAACGAGTACAGGACGTAATTGAGCGATTTTGGGATTTCATTGACCAGCTGAGCATCAACACTTTTGGGAATAGCAGTGAGTGCCCCCCACCCGGAGATGCTGAAGATGACACTGTGTGCTTGGACCTTGGCAAGTGCAAGGCTGGGAAATGCATCCCTTTCTGCAA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

6

Interacting miRNAs (#binding sites)

mmu-miR-23b-3p(1), mmu-miR-135a-5p(1), mmu-miR-23a-3p(1), mmu-miR-25-3p(1), mmu-miR-676-3p(1), mmu-miR-1904(1)

siRNAs for circular RNA silencing
Junction sequence

ATCAACACTTTTGGGAATAGCAGTGA

siRNA sets

TATTCCCAAAAGTGTTGAT, ACTGCTATTCCCAAAAGTG, CTATTCCCAAAAGTGTTGA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCADAM17_345_ORF_1

0.7642

0.259071164

0.578568746

429

ORF sequence:

ATGAATGGCAAATGTGAGAAACGAGTACAGGACGTAATTGAGCGATTTTGGGATTTCATTGACCAGCTGAGCATCAACACTTTTGGGAATAGCAGTGAGTGCCCCCCACCCGGAGATGCTGAAGATGACACTGTGTGCTTGGACCTTGGCAAGTGCAAGGCTGGGAAATGCATCCCTTTCTGCAAGAGGGAGCAGGAGCTGGAGTCCTGCGCATGCGTTGACACTGACAACTCGTGCAAGGTGTGCTGCAGGAACCTTTCTGGCCCGTGTGTGCCGTACGTCGATGCAGAGCAAAAGAACTTGTTTTTGAGGAAAGGGAAGCCATGTACAGTAGGGTTTTGCGACATGAATGGCAAATGTGAGAAACGAGTACAGGACGTAATTGAGCGATTTTGGGATTTCATTGACCAGCTGAGCATCAACACTTTT

Peptide sequence:

MNGKCEKRVQDVIERFWDFIDQLSINTFGNSSECPPPGDAEDDTVCLDLGKCKAGKCIPFCKREQELESCACVDTDNSCKVCCRNLSGPCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTF

IRESfinder result

IRESfinder score

0.351436148

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page