top of page

mmu_circ1700029J07Rik_611

Basic information of circular RNA
PanCircBase ID:

mmu_circ1700029J07Rik_611

mm39_Chr. Position ID:

chr8|46420892|46426717|-

Gene name:

1700029J07Rik

Transcript:

ENSMUST00000098786.3

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

4

Exon/intron indexes:

5,4,3,2

Exon/intron offsets:

0,171,2498,5648

Genomic length:

5825

Exon/intron sizes in nt:

76,13,82,20,177

Flanking exon/introns:

chr8:46415470-46420892|chr8:46426717-46428115

Splice length:

611

Other database IDs:

circAtlas: mmu-1700029J07Rik_0007

Human Ortholog IDs:
Mature spliced Sequence:

TTTTCAGTGTAAAGTAGGATTTTGCTGCAAAAGAAGATCTAAGAACCTTTGTGAAGTTACCACCCCAAGGAGCAATCATGCCGATAGAAGGTGGGAAAACAGATATGGAGAGGATTGGCCTCTTCAGTGAGATGGAATACATCACTGTGGGCGACAAATATGTGTCACCATTTAATCGACCCTTTAATGAGGCTGCAAGCAAAAATAGACAGATCCTACCGGGGGGAACCAAAGAAATGTCCAGTCTCCAGGCAGGATACTTTGATTCCCAGTTTGCAAGGATTTTTGAAGGGGAAGGCTACGTGAATTTGAATCAAGTGAGGAGACGGTATATGCTGGCAGAATCCAAAAAGAACCTAGGCAAAGCTTTCATCCCTAGTAGCGGAGAGAAAAAGCCAAGTGGATTAGGAAGCTATTATGGAACAATTGGTGGTCCTGTCCCATTCTTCAGTGCTCAGATAAAACCCAAGGACAAGTATCAGCCACCGGGGAAGAATTTATATACCAACCCAGGAAAAAAAGGAACTGGATATGGCTATGCCAATGTTACCATAGGCAAGCAGCTTTCACATTCTTCTGACTTATATGACGCAGCGAGACAGAGTTATAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CCATAGGCAAGCAGCTTTCAC

59.87

ATGATTGCTCCTTGGGGTGG

60.03

141

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ACCATAGGCAAGCAGCTTTCA

60.27

ATGATTGCTCCTTGGGGTGG

60.03

142

PCR template sequence:

AGGAAAAAAAGGAACTGGATATGGCTATGCCAATGTTACCATAGGCAAGCAGCTTTCACATTCTTCTGACTTATATGACGCAGCGAGACAGAGTTATAAGTTTTCAGTGTAAAGTAGGATTTTGCTGCAAAAGAAGATCTAAGAACCTTTGTGAAGTTACCACCCCAAGGAGCAATCATGCCGATAGAAGGTGGGAAAAC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-9-5p(1), mmu-miR-362-5p(1), mmu-miR-350-3p(1)

siRNAs for circular RNA silencing
Junction sequence

ACAGAGTTATAAGTTTTCAGTGTAAA

siRNA sets

CTGAAAACTTATAACTCTG, TTTACACTGAAAACTTATA, ACTGAAAACTTATAACTCT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRC1700029J07RIK_611_ORF_1

0.6714

0.119825933

0.600342562

546

ORF sequence:

ATGCCGATAGAAGGTGGGAAAACAGATATGGAGAGGATTGGCCTCTTCAGTGAGATGGAATACATCACTGTGGGCGACAAATATGTGTCACCATTTAATCGACCCTTTAATGAGGCTGCAAGCAAAAATAGACAGATCCTACCGGGGGGAACCAAAGAAATGTCCAGTCTCCAGGCAGGATACTTTGATTCCCAGTTTGCAAGGATTTTTGAAGGGGAAGGCTACGTGAATTTGAATCAAGTGAGGAGACGGTATATGCTGGCAGAATCCAAAAAGAACCTAGGCAAAGCTTTCATCCCTAGTAGCGGAGAGAAAAAGCCAAGTGGATTAGGAAGCTATTATGGAACAATTGGTGGTCCTGTCCCATTCTTCAGTGCTCAGATAAAACCCAAGGACAAGTATCAGCCACCGGGGAAGAATTTATATACCAACCCAGGAAAAAAAGGAACTGGATATGGCTATGCCAATGTTACCATAGGCAAGCAGCTTTCACATTCTTCTGACTTATATGACGCAGCGAGACAGAGTTATAAGTTTTCAGTGTAA

Peptide sequence:

MPIEGGKTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQLSHSSDLYDAARQSYKFSV

IRESfinder result

IRESfinder score

0.462739707

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page