top of page

mmu_ciArfgef2_125

Basic information of circular RNA
PanCircBase ID:

mmu_ciArfgef2_125

mm39_Chr. Position ID:

chr2|166702318|166702443|+

Gene name:

Arfgef2

Transcript:

ENSMUST00000099078.10

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

17

Exon/intron offsets:

0

Genomic length:

125

Exon/intron sizes in nt:

125

Flanking exon/introns:

chr2:166702318-166702444

Splice length:

125

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTAAAATGCCCCATGGTTTGTATAGCGTGGCTGCAGACATGGCTGAATTTGTTAGGGCATTTCAGTGTTTTAAAAATGTTTTTCTTTTTTTCCTTTTTCTTTTTTTCTTTCTTTTTTCAATTTCA

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

NA

NA

NA

NA

NA

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

NA

NA

NA

NA

NA

PCR template sequence:

AGTGTTTTAAAAATGTTTTTCTTTTTTTCCTTTTTCTTTTTTTCTTTCTTTTTTCAATTTCAGTAAAATGCCCCATGGTTTGTATAGCGTGGCTGCAGACATGGCTGAATTTGTTAGGGCATTT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-495-3p(1), mmu-miR-7a-1-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TTTTTCAATTTCAGTAAAATGCCCCA

siRNA sets

TTTTACTGAAATTGAAAAA, ATTTTACTGAAATTGAAAA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIARFGEF2_125_ORF_1

0.4841

-0.597400572

0.006447076

243

ORF sequence:

ATGCCCCATGGTTTGTATAGCGTGGCTGCAGACATGGCTGAATTTGTTAGGGCATTTCAGTGTTTTAAAAATGTTTTTCTTTTTTTCCTTTTTCTTTTTTTCTTTCTTTTTTCAATTTCAGTAAAATGCCCCATGGTTTGTATAGCGTGGCTGCAGACATGGCTGAATTTGTTAGGGCATTTCAGTGTTTTAAAAATGTTTTTCTTTTTTTCCTTTTTCTTTTTTTCTTTCTTTTTTCAATTT

Peptide sequence:

MPHGLYSVAADMAEFVRAFQCFKNVFLFFLFLFFFLFSISVKCPMVCIAWLQTWLNLLGHFSVLKMFFFFSFFFFSFFFQF

IRESfinder result

IRESfinder score

0.990869942

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page