top of page

mmu_ciAkap8_399

Basic information of circular RNA
PanCircBase ID:

mmu_ciAkap8_399

mm39_Chr. Position ID:

chr17|32535641|32536040|-

Gene name:

Akap8

Transcript:

ENSMUST00000002699.7

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

4

Exon/intron offsets:

0

Genomic length:

399

Exon/intron sizes in nt:

399

Flanking exon/introns:

chr17:32535641-32536040

Splice length:

399

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTGATTATGGCCTTCAACCTTTGCTCATGGAATCCCTTTCTGGAATCACGGGAGTGGGTACCAGCTCTTTTAGAAAGCCCTCTTTCCTGTTCCTCCTTTAGGCTGGAGTTGGACCCTGTGGGGTGGGCTTCACTGAAGGTTTCCTAAACTGCTGGCCAATGAGCCTAAGATTCTTTGTTCTGGCAAGGGCTTCATGCTCTTTCTTTGTTAGCAGTGTTTGAATGAGTGTTCTTAGGCTAGTTTGCCTTCTGGGCATTTAGGTAGATACTGACTGGGTGGGTTGGTTTCTTGTTCTGAATGTAAGAGGTCCAACTTAGTGTAAAGTTAGGCTGAGGGCAGATTATTGGGTAGCCTGGATGGCTTAGGCTGCTCCTAATGGGCTGTATACTTCCTTTGCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CTGGATGGCTTAGGCTGCTC

60.53

GGAGGAACAGGAAAGAGGGC

60.03

143

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GATGGCTTAGGCTGCTCCTA

58.95

GGAGGAACAGGAAAGAGGGC

60.03

140

PCR template sequence:

GTAAGAGGTCCAACTTAGTGTAAAGTTAGGCTGAGGGCAGATTATTGGGTAGCCTGGATGGCTTAGGCTGCTCCTAATGGGCTGTATACTTCCTTTGCAGGTGATTATGGCCTTCAACCTTTGCTCATGGAATCCCTTTCTGGAATCACGGGAGTGGGTACCAGCTCTTTTAGAAAGCCCTCTTTCCTGTTCCTCCTTTA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-200a-3p(1), mmu-miR-141-3p(1), mmu-miR-541-5p(1)

siRNAs for circular RNA silencing
Junction sequence

ACTTCCTTTGCAGGTGATTATGGCCT

siRNA sets

CCATAATCACCTGCAAAGG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIAKAP8_399_ORF_1

0.6366

-0.132068436

0.032801927

171

ORF sequence:

ATGGGCTGTATACTTCCTTTGCAGGTGATTATGGCCTTCAACCTTTGCTCATGGAATCCCTTTCTGGAATCACGGGAGTGGGTACCAGCTCTTTTAGAAAGCCCTCTTTCCTGTTCCTCCTTTAGGCTGGAGTTGGACCCTGTGGGGTGGGCTTCACTGAAGGTTTCCTAA

Peptide sequence:

MGCILPLQVIMAFNLCSWNPFLESREWVPALLESPLSCSSFRLELDPVGWASLKVS

IRESfinder result

IRESfinder score

0.816350729

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page