top of page

mmu_circBtrc_1332

Basic information of circular RNA
PanCircBase ID:

mmu_circBtrc_1332

mm39_Chr. Position ID:

chr19|45491370|45507959|+

Gene name:

Btrc

Transcript:

ENSMUST00000065601.13

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

9

Exon/intron indexes:

5,6,7,8,9,10,11,12,13

Exon/intron offsets:

0,4752,9713,10455,11076,12926,14083,15877,16510

Genomic length:

16589

Exon/intron sizes in nt:

232,187,97,138,119,250,119,111,79

Flanking exon/introns:

chr19:45459543-45491370|chr19:45507959-45515702

Splice length:

1332

Other database IDs:

CIRCpedia: MMU_CIRCpedia_20579, circAtlas: mmu-Btrc_0007

circBase: hsa_circ_0019569, circAtlas: hsa-BTRC_0007, CIRCpedia: HSA_CIRCpedia_110

Human Ortholog IDs:
Mature spliced Sequence:

GCCAAACTTGCCAATGGCACTTCCAGCATGATTGTGCCCAAGCAGCGGAAACTCTCAGCAAGCTATGAGAAGGAAAAGGAGCTGTGTGTCAAGTATTTTGAGCAGTGGTCAGAGTCTGATCAAGTGGAATTTGTAGAACACCTTATATCCCAAATGTGTCACTACCAGCATGGGCACATCAACTCCTACCTAAAACCTATGCTGCAGAGGGATTTCATAACTGCACTGCCAGCACGGGGTCTGGACCACATCGCTGAGAACATTCTGTCATACTTGGACGCCAAGTCACTGTGTGCTGCTGAGCTCGTGTGCAAGGAATGGTACCGCGTGACGTCGGACGGCATGCTGTGGAAAAAGCTCATCGAGAGGATGGTCAGGACGGACTCTCTGTGGCGAGGCCTGGCAGAGCGCAGAGGCTGGGGACAGTACTTATTCAAAAACAAACCTCCTGATGAGAACGCTCCTCCCAACTCCTTTTATAGAGCGCTTTATCCTAAAATCATACAAGACATTGAGACAATAGAGTCCAATTGGAGATGTGGGCGACATAGTTTACAGAGAATCCACTGCCGGAGTGAAACAAGTAAAGGGGTTTACTGTTTACAGTACGACGACCAGAAGATAGTCAGCGGCCTTCGAGACAACACCATCAAGATCTGGGATAAAAGCACACTGGAATGCAAGCGGATTCTCACGGGCCACACGGGCTCCGTCCTGTGTCTGCAGTACGATGAGAGGGTGATCATCACAGGCTCCTCAGACTCCACCGTCAGAGTGTGGGATGTAAATGCAGGTGAGATGCTAAACACATTGATTCACCACTGTGAAGCCGTTCTGCACCTGCGCTTCAATAATGGCATGATGGTGACCTGTTCCAAAGACCGTTCCATCGCTGTGTGGGATATGGCTTCCCCAACTGACATCACCCTCAGGAGGGTGCTGGTGGGACACCGAGCTGCGGTCAATGTTGTAGACTTTGATGACAAGTACATCGTTTCTGCCTCTGGAGATAGAACCATAAAGGTGTGGAACACAAGTACCTGTGAATTCGTAAGGACCCTAAATGGGCACAAGCGTGGCATCGCCTGTTTGCAGTACAGAGACAGGCTGGTGGTGAGCGGCTCCTCTGACAACACCATCAGGCTGTGGGACATAGAGTGTGGAGCATGCCTGCGAGTGTTGGAGGGCCATGAGGAGTTGGTACGCTGCATTCGATTTGATAACAAAAGGATAGTGAGCGGAGCCTATGATGGGAAAATTAAAGTGTGGGATCTTATGGCTGCTTTGGACCCGCGTGCTCCAGCAGGGACTCTCTGTCTGCGGACACTTGTG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TTATGGCTGCTTTGGACCCG

60.68

TGACACACAGCTCCTTTTCCT

59.51

150

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TATGGCTGCTTTGGACCCG

60.08

TGACACACAGCTCCTTTTCCT

59.51

149

PCR template sequence:

AGTGAGCGGAGCCTATGATGGGAAAATTAAAGTGTGGGATCTTATGGCTGCTTTGGACCCGCGTGCTCCAGCAGGGACTCTCTGTCTGCGGACACTTGTGGCCAAACTTGCCAATGGCACTTCCAGCATGATTGTGCCCAAGCAGCGGAAACTCTCAGCAAGCTATGAGAAGGAAAAGGAGCTGTGTGTCAAGTATTTTG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

19

Interacting miRNAs (#binding sites)

mmu-miR-34c-5p(2), mmu-miR-34b-5p(2), mmu-miR-16-5p(1), mmu-miR-15a-5p(1), mmu-miR-27b-3p(1), mmu-miR-27a-3p(1), mmu-miR-223-3p(1), mmu-miR-34a-5p(1), mmu-miR-322-5p(1), mmu-miR-15b-5p(1), mmu-miR-148a-3p(1), mmu-miR-328-3p(1), mmu-miR-709(1), mmu-miR-128-3p(1), mmu-miR-96-5p(1), mmu-miR-370-3p(1), mmu-miR-383-5p(1), mmu-miR-98-5p(1), mmu-miR-669d-5p(1)

siRNAs for circular RNA silencing
Junction sequence

GCGGACACTTGTGGCCAAACTTGCCA

siRNA sets

CAAGTTTGGCCACAAGTGT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBTRC_1332_ORF_1

0.9107

0.281606327

0.999999936

2637

ORF sequence:

ATGATTGTGCCCAAGCAGCGGAAACTCTCAGCAAGCTATGAGAAGGAAAAGGAGCTGTGTGTCAAGTATTTTGAGCAGTGGTCAGAGTCTGATCAAGTGGAATTTGTAGAACACCTTATATCCCAAATGTGTCACTACCAGCATGGGCACATCAACTCCTACCTAAAACCTATGCTGCAGAGGGATTTCATAACTGCACTGCCAGCACGGGGTCTGGACCACATCGCTGAGAACATTCTGTCATACTTGGACGCCAAGTCACTGTGTGCTGCTGAGCTCGTGTGCAAGGAATGGTACCGCGTGACGTCGGACGGCATGCTGTGGAAAAAGCTCATCGAGAGGATGGTCAGGACGGACTCTCTGTGGCGAGGCCTGGCAGAGCGCAGAGGCTGGGGACAGTACTTATTCAAAAACAAACCTCCTGATGAGAACGCTCCTCCCAACTCCTTTTATAGAGCGCTTTATCCTAAAATCATACAAGACATTGAGACAATAGAGTCCAATTGGAGATGTGGGCGACATAGTTTACAGAGAATCCACTGCCGGAGTGAAACAAGTAAAGGGGTTTACTGTTTACAGTACGACGACCAGAAGATAGTCAGCGGCCTTCGAGACAACACCATCAAGATCTGGGATAAAAGCACACTGGAATGCAAGCGGATTCTCACGGGCCACACGGGCTCCGTCCTGTGTCTGCAGTACGATGAGAGGGTGATCATCACAGGCTCCTCAGACTCCACCGTCAGAGTGTGGGATGTAAATGCAGGTGAGATGCTAAACACATTGATTCACCACTGTGAAGCCGTTCTGCACCTGCGCTTCAATAATGGCATGATGGTGACCTGTTCCAAAGACCGTTCCATCGCTGTGTGGGATATGGCTTCCCCAACTGACATCACCCTCAGGAGGGTGCTGGTGGGACACCGAGCTGCGGTCAATGTTGTAGACTTTGATGACAAGTACATCGTTTCTGCCTCTGGAGATAGAACCATAAAGGTGTGGAACACAAGTACCTGTGAATTCGTAAGGACCCTAAATGGGCACAAGCGTGGCATCGCCTGTTTGCAGTACAGAGACAGGCTGGTGGTGAGCGGCTCCTCTGACAACACCATCAGGCTGTGGGACATAGAGTGTGGAGCATGCCTGCGAGTGTTGGAGGGCCATGAGGAGTTGGTACGCTGCATTCGATTTGATAACAAAAGGATAGTGAGCGGAGCCTATGATGGGAAAATTAAAGTGTGGGATCTTATGGCTGCTTTGGACCCGCGTGCTCCAGCAGGGACTCTCTGTCTGCGGACACTTGTGGCCAAACTTGCCAATGGCACTTCCAGCATGATTGTGCCCAAGCAGCGGAAACTCTCAGCAAGCTATGAGAAGGAAAAGGAGCTGTGTGTCAAGTATTTTGAGCAGTGGTCAGAGTCTGATCAAGTGGAATTTGTAGAACACCTTATATCCCAAATGTGTCACTACCAGCATGGGCACATCAACTCCTACCTAAAACCTATGCTGCAGAGGGATTTCATAACTGCACTGCCAGCACGGGGTCTGGACCACATCGCTGAGAACATTCTGTCATACTTGGACGCCAAGTCACTGTGTGCTGCTGAGCTCGTGTGCAAGGAATGGTACCGCGTGACGTCGGACGGCATGCTGTGGAAAAAGCTCATCGAGAGGATGGTCAGGACGGACTCTCTGTGGCGAGGCCTGGCAGAGCGCAGAGGCTGGGGACAGTACTTATTCAAAAACAAACCTCCTGATGAGAACGCTCCTCCCAACTCCTTTTATAGAGCGCTTTATCCTAAAATCATACAAGACATTGAGACAATAGAGTCCAATTGGAGATGTGGGCGACATAGTTTACAGAGAATCCACTGCCGGAGTGAAACAAGTAAAGGGGTTTACTGTTTACAGTACGACGACCAGAAGATAGTCAGCGGCCTTCGAGACAACACCATCAAGATCTGGGATAAAAGCACACTGGAATGCAAGCGGATTCTCACGGGCCACACGGGCTCCGTCCTGTGTCTGCAGTACGATGAGAGGGTGATCATCACAGGCTCCTCAGACTCCACCGTCAGAGTGTGGGATGTAAATGCAGGTGAGATGCTAAACACATTGATTCACCACTGTGAAGCCGTTCTGCACCTGCGCTTCAATAATGGCATGATGGTGACCTGTTCCAAAGACCGTTCCATCGCTGTGTGGGATATGGCTTCCCCAACTGACATCACCCTCAGGAGGGTGCTGGTGGGACACCGAGCTGCGGTCAATGTTGTAGACTTTGATGACAAGTACATCGTTTCTGCCTCTGGAGATAGAACCATAAAGGTGTGGAACACAAGTACCTGTGAATTCGTAAGGACCCTAAATGGGCACAAGCGTGGCATCGCCTGTTTGCAGTACAGAGACAGGCTGGTGGTGAGCGGCTCCTCTGACAACACCATCAGGCTGTGGGACATAGAGTGTGGAGCATGCCTGCGAGTGTTGGAGGGCCATGAGGAGTTGGTACGCTGCATTCGATTTGATAACAAAAGGATAGTGAGCGGAGCCTATGATGGGAAAATTAAAGTGTGGGATCTTATGGCTGCTTTGGACCCGCGTGCTCCAGCAGGGACTCTCTGTCTGCGGACACTTGTG

Peptide sequence:

MIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDENAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVAKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDENAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLV

IRESfinder result

IRESfinder score

0.373411736

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page