top of page

mmu_circBtbd7_305

Basic information of circular RNA
PanCircBase ID:

mmu_circBtbd7_305

mm39_Chr. Position ID:

chr12|102761431|102774319|-

Gene name:

Btbd7

Transcript:

ENSMUST00000223554.2

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

8,7

Exon/intron offsets:

0,12727

Genomic length:

12888

Exon/intron sizes in nt:

1,44,161

Flanking exon/introns:

chr12:102760194-102761431|chr12:102774319-102777378

Splice length:

305

Other database IDs:

circBase: mmu_circ_0003673, CIRCpedia: MMU_CIRCpedia_773, circAtlas: mmu-Btbd7_0012

circAtlas: hsa-BTBD7_0015, CIRCpedia: HSA_CIRCpedia_118142

Human Ortholog IDs:
Mature spliced Sequence:

AGCCAAACTTACTGAGTGGCACTGCACATAGTGTGAACAAAAGAGGTGTGAAGAGAAGAGACCTGGACATAGAAGAACTTAGAGAGATCCTTTCTTCTCTCTTGCCTTTTGTGCGGATTGAACACATCCTACCTATAAACAGTGAGGTCTTAAGTGATGCAATGAAAAGAGGCTTGATCAGCACGCCGCCATCAGACATGCTTCCTACAGCAGAGGGCGGGAAATCAAACGCCTGGCTGCGGCAGAAGAACGCTGGCATATATGTTCGTCCTCGGCTGTTTTCTCCCTATGTGGAGGAAGCAAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GGAAATCAAACGCCTGGCTG

60.11

CCAGGTCTCTTCTCTTCACACC

60.03

152

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

AGAGGGCGGGAAATCAAACG

60.68

CCAGGTCTCTTCTCTTCACACC

60.03

160

PCR template sequence:

TACAGCAGAGGGCGGGAAATCAAACGCCTGGCTGCGGCAGAAGAACGCTGGCATATATGTTCGTCCTCGGCTGTTTTCTCCCTATGTGGAGGAAGCAAAGAGCCAAACTTACTGAGTGGCACTGCACATAGTGTGAACAAAAGAGGTGTGAAGAGAAGAGACCTGGACATAGAAGAACTTAGAGAGATCCTTTCTTCTCT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

1

Interacting miRNAs (#binding sites)

mmu-miR-335-3p(1)

siRNAs for circular RNA silencing
Junction sequence

GGAGGAAGCAAAGAGCCAAACTTACT

siRNA sets

GTAAGTTTGGCTCTTTGCT, AGTAAGTTTGGCTCTTTGC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBTBD7_305_ORF_1

0.5433

0.170040075

0.082833308

159

ORF sequence:

ATGAAAAGAGGCTTGATCAGCACGCCGCCATCAGACATGCTTCCTACAGCAGAGGGCGGGAAATCAAACGCCTGGCTGCGGCAGAAGAACGCTGGCATATATGTTCGTCCTCGGCTGTTTTCTCCCTATGTGGAGGAAGCAAAGAGCCAAACTTACTGA

Peptide sequence:

MKRGLISTPPSDMLPTAEGGKSNAWLRQKNAGIYVRPRLFSPYVEEAKSQTY

IRESfinder result

IRESfinder score

0.413305551

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page