top of page

mmu_circBrinp2_345

Basic information of circular RNA
PanCircBase ID:

mmu_circBrinp2_345

mm39_Chr. Position ID:

chr1|158122995|158123340|-

Gene name:

Brinp2

Transcript:

ENSMUST00000195271.5

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

1

Exon/intron indexes:

3

Exon/intron offsets:

0

Genomic length:

345

Exon/intron sizes in nt:

345

Flanking exon/introns:

chr1:158095590-158122995|chr1:158123340-158183086

Splice length:

345

Other database IDs:

CIRCpedia: MMU_CIRCpedia_10929, circAtlas: mmu-Brinp2_0002

Human Ortholog IDs:
Mature spliced Sequence:

TTTGGCGCCCTGGAGGAGCAGCGCGGAGTGGGAGAGCTTGGCGAGAGAATGAAGACACTAACCGCCTGGGAGAAGCATGAGGTGGCCGTGCAGCTCTTGGTTTAGAGGGCTTTGGCCGGAGGCCGCCCCATGGGCAGTCCTGCTGGCGCTAGGCGTACCCGGGTGGGTGCTGGCTGTCTCGGCCACGGTGGCCGCTGTGGTCCCGGAACAGCATGTCTCCTCAGCTGGCCAGGCTCCCCTGGACTGGCTGCTCACAGACCGAGGCCCCTTCCACCGAGCCCAGGAGTATGCTGATTTCATGGAGCGTTACCGCCAGGGGTTCACCACCAGATACAGGATCTACAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CACCGAGCCCAGGAGTATG

59.56

CACCTCATGCTTCTCCCAGG

60.11

158

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CACCGAGCCCAGGAGTATG

59.56

CCACCTCATGCTTCTCCCAG

60.11

159

PCR template sequence:

GGCTGCTCACAGACCGAGGCCCCTTCCACCGAGCCCAGGAGTATGCTGATTTCATGGAGCGTTACCGCCAGGGGTTCACCACCAGATACAGGATCTACAGTTTGGCGCCCTGGAGGAGCAGCGCGGAGTGGGAGAGCTTGGCGAGAGAATGAAGACACTAACCGCCTGGGAGAAGCATGAGGTGGCCGTGCAGCTCTTGG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

NA

Interacting miRNAs (#binding sites)

NA

siRNAs for circular RNA silencing
Junction sequence

ACAGGATCTACAGTTTGGCGCCCTGG

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBRINP2_345_ORF_1

0.9153

0.218309845

0.413840731

321

ORF sequence:

ATGAGGTGGCCGTGCAGCTCTTGGTTTAGAGGGCTTTGGCCGGAGGCCGCCCCATGGGCAGTCCTGCTGGCGCTAGGCGTACCCGGGTGGGTGCTGGCTGTCTCGGCCACGGTGGCCGCTGTGGTCCCGGAACAGCATGTCTCCTCAGCTGGCCAGGCTCCCCTGGACTGGCTGCTCACAGACCGAGGCCCCTTCCACCGAGCCCAGGAGTATGCTGATTTCATGGAGCGTTACCGCCAGGGGTTCACCACCAGATACAGGATCTACAGTTTGGCGCCCTGGAGGAGCAGCGCGGAGTGGGAGAGCTTGGCGAGAGAATGA

Peptide sequence:

MRWPCSSWFRGLWPEAAPWAVLLALGVPGWVLAVSATVAAVVPEQHVSSAGQAPLDWLLTDRGPFHRAQEYADFMERYRQGFTTRYRIYSLAPWRSSAEWESLARE

IRESfinder result

IRESfinder score

0.269332235

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

RPF, cORF, m6A

mmu_circBrinp2_001

Evidence
Peptide sequence:

MRWPCSSWFRGLWPEAAPWAVLLALGVPGWVLAVSATVAAVVPEQHVSSAGQAPLDWLLTDRGPFHRAQEYADFMERYRQGFTTRYRIYSLAPWRSSAEWESLARE*

bottom of page