top of page

mmu_circBrd8_340

Basic information of circular RNA
PanCircBase ID:

mmu_circBrd8_340

mm39_Chr. Position ID:

chr18|34736759|34737976|-

Gene name:

Brd8

Transcript:

ENSMUST00000003876.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

19,18,17

Exon/intron offsets:

0,891,1124

Genomic length:

1217

Exon/intron sizes in nt:

178,69,93

Flanking exon/introns:

chr18:34735829-34736759|chr18:34737976-34738526

Splice length:

340

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

TTCCGTGTGCAGTGAAGATCAAGAAGCAATTCAGGCTCAGAAAATATGGAAGAAAGCCATCATGCTTGTATGGAGGGCTGCAGCAAATCATAGGTATGCCAATGTGTTCCTGCAACCTGTTACAGATGACATAGCTCCTGGTTACCATAGCATTGTACAGAGGCCTATGGATTTGTCAACTATAAAGAAAAACATTGAAAATGGACTGATCCGAAGCACAGCTGAGTTTCAGCGTGACATCATGCTGATGTTTCAGAATGCTGTTATGTACAATAGCTCAGACCATGATGTCTATCACATGGCAGTAGAGATGCAGAGAGATGTCTTGGAACAGATCCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TCACATGGCAGTAGAGATGCA

59.17

CCTATGATTTGCTGCAGCCC

59.33

140

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TCACATGGCAGTAGAGATGCAG

60.16

CCTATGATTTGCTGCAGCCC

59.33

140

PCR template sequence:

CATGCTGATGTTTCAGAATGCTGTTATGTACAATAGCTCAGACCATGATGTCTATCACATGGCAGTAGAGATGCAGAGAGATGTCTTGGAACAGATCCAGTTCCGTGTGCAGTGAAGATCAAGAAGCAATTCAGGCTCAGAAAATATGGAAGAAAGCCATCATGCTTGTATGGAGGGCTGCAGCAAATCATAGGTATGCC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-135a-5p(1), mmu-miR-381-3p(1), mmu-miR-218-5p(1)

siRNAs for circular RNA silencing
Junction sequence

GGAACAGATCCAGTTCCGTGTGCAGT

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBRD8_340_ORF_1

1.0783

0.185251008

0.525362054

360

ORF sequence:

ATGTCTTGGAACAGATCCAGTTCCGTGTGCAGTGAAGATCAAGAAGCAATTCAGGCTCAGAAAATATGGAAGAAAGCCATCATGCTTGTATGGAGGGCTGCAGCAAATCATAGGTATGCCAATGTGTTCCTGCAACCTGTTACAGATGACATAGCTCCTGGTTACCATAGCATTGTACAGAGGCCTATGGATTTGTCAACTATAAAGAAAAACATTGAAAATGGACTGATCCGAAGCACAGCTGAGTTTCAGCGTGACATCATGCTGATGTTTCAGAATGCTGTTATGTACAATAGCTCAGACCATGATGTCTATCACATGGCAGTAGAGATGCAGAGAGATGTCTTGGAACAGATCCAG

Peptide sequence:

MSWNRSSSVCSEDQEAIQAQKIWKKAIMLVWRAAANHRYANVFLQPVTDDIAPGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQ

IRESfinder result

IRESfinder score

0.341398691

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page