top of page

mmu_circBmi1_220

Basic information of circular RNA
PanCircBase ID:

mmu_circBmi1_220

mm39_Chr. Position ID:

chr2|18688179|18688877|+

Gene name:

Bmi1

Transcript:

ENSMUST00000028071.13

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

7,8,9

Exon/intron offsets:

0,296,617

Genomic length:

698

Exon/intron sizes in nt:

40,99,81

Flanking exon/introns:

chr2:18688094-18688179|chr2:18688877-18688962

Splice length:

220

Other database IDs:

circAtlas: hsa-COMMD3-BMI1_0006

Human Ortholog IDs:
Mature spliced Sequence:

ATTGGATCGGAAAGTAAATAAAGAGAAGCCTAAGGAAGAGGTGAATGATAAAAGGTACTTACGATGCCCAGCAGCAATGACTGTGATGCACTTGAGAAAGTTTCTCAGGAGTAAAATGGACATACCCAATACTTTCCAGATTGACGTCATGTATGAAGAGGAACCTTTAAAGGATTACTACACGCTAATGGACATTGCCTACATTTATACCTGGAGAAGA

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

ACGTCATGTATGAAGAGGAACCT

59.23

TGCTGGGCATCGTAAGTACC

59.82

150

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ACGTCATGTATGAAGAGGAACCT

59.23

GCTGCTGGGCATCGTAAGTA

60.18

152

PCR template sequence:

CATACCCAATACTTTCCAGATTGACGTCATGTATGAAGAGGAACCTTTAAAGGATTACTACACGCTAATGGACATTGCCTACATTTATACCTGGAGAAGAATTGGATCGGAAAGTAAATAAAGAGAAGCCTAAGGAAGAGGTGAATGATAAAAGGTACTTACGATGCCCAGCAGCAATGACTGTGATGCACTTGAGAAAG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-34a-5p(1), mmu-miR-148b-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TACCTGGAGAAGAATTGGATCGGAAA

siRNA sets

ATCCAATTCTTCTCCAGGT, TTTCCGATCCAATTCTTCT, GATCCAATTCTTCTCCAGG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBMI1_220_ORF_1

0.9371

0.100981961

0.129299035

165

ORF sequence:

ATGACTGTGATGCACTTGAGAAAGTTTCTCAGGAGTAAAATGGACATACCCAATACTTTCCAGATTGACGTCATGTATGAAGAGGAACCTTTAAAGGATTACTACACGCTAATGGACATTGCCTACATTTATACCTGGAGAAGAATTGGATCGGAAAGTAAATAA

Peptide sequence:

MTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRIGSESK

IRESfinder result

IRESfinder score

0.427426379

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page