top of page

mmu_circBirc6_1093

Basic information of circular RNA
PanCircBase ID:

mmu_circBirc6_1093

mm39_Chr. Position ID:

chr17|74853231|74873169|+

Gene name:

Birc6

Transcript:

ENSMUST00000180037.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

2,3,4,5,6,7

Exon/intron offsets:

0,2476,11664,14914,15782,19554

Genomic length:

19938

Exon/intron sizes in nt:

182,138,194,112,83,384

Flanking exon/introns:

chr17:74835796-74853231|chr17:74873169-74880567

Splice length:

1093

Other database IDs:

CIRCpedia: MMU_CIRCpedia_28763, circAtlas: mmu-Birc6_0002

circBase: hsa_circ_0007337, circAtlas: hsa-BIRC6_0002, CIRCpedia: HSA_CIRCpedia_40783

Human Ortholog IDs:
Mature spliced Sequence:

CTAAACCAGGTGGACAGGTGAAATGTCAGTATATTTCTGCTGTGGATAAAGTGATATTTGTGGATGATTACGCCGTGGGCTGTAGGAAGGACCTTAATGGGATCTTGTTGCTAGACACTGCTCTGCAAACTCCAGTTTCAAAGCAGGACGATGTGGTTCAGCTGGAACTTCCCGTCACAGAGGCACAGCAGCTCTTATCAGCATGTATAGAAAAGATAGATGTTTCTAGTACAGAGGGTTATGATTTGTTCATCACACAGCTCAAAGATGGTTTAAAAAATACATCTCATGAAACTGCAGCAAACCATAAAGTTGCTAAGTGGGCCACAGTTACATTTCATCTTCCTCATCACGTATTGAAGTCTATTGCCAGTGCCATTGTAAATGAACTTAAGAAAATAAATCAAAATGTTGCTGCCTTACCTGTGGCGTCCTCAGTGATGGACAGATTGTCTTACCTCTTGCCCAGTGCACGTCCAGAACTTGGAGTTGGGCCAGGCCGTTCTGTAGACAGGGCATTGATGTATAGTGAAGCTAACAGAAGGGAGACCTTCACTTCGTGGCCTCATGTTGGCTATAGGTGGGCACAGCCAGATCCCATGGCTCAAGCTGGATTTTATCACCAGCCTGCTTCATCTGGAGATGATAGAGCCATGTGTTTTACTTGTAGTGTTTGCCTCGTTTGTTGGGAGCCTACGGATGAACCTTGGTCCGAACATGAGAGACACTCTCCCAACTGTCCCTTTGTGAAGGGTGAGCACACCCAGAATGTGCCCTTGTCAGTCACCCTGGCAACGAGTCCTGCGCAGCTCCCTTCTGCAGATGGAGCTGACAGAATAGCTTGCTTTGGGTCTGGGAGCTGTCCTCAGTTTCTAGCTGCTGCAACCAAACGTGGGAAGATCTGCATATGGGACGTCTCCAAACTCATGAAGGTGCACTTGAAGTTTGAAATTAATGCCTATGACCCAGCAATCGTGCAACAGCTGATCCTATCAGGAGACCCAAGTTCAGGAGTTGATTCAAGGAGACCCACTTTGGCATGGCTGGAAGACTCTTCTAGTTGCTCAGACATACCGAAACTGGAAGGAGACAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

AGGAGACCCACTTTGGCATG

59.96

CCACGGCGTAATCATCCACA

60.46

149

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TCAAGGAGACCCACTTTGGC

59.89

CCACGGCGTAATCATCCACA

60.46

152

PCR template sequence:

CAGGAGACCCAAGTTCAGGAGTTGATTCAAGGAGACCCACTTTGGCATGGCTGGAAGACTCTTCTAGTTGCTCAGACATACCGAAACTGGAAGGAGACAGCTAAACCAGGTGGACAGGTGAAATGTCAGTATATTTCTGCTGTGGATAAAGTGATATTTGTGGATGATTACGCCGTGGGCTGTAGGAAGGACCTTAATGG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

11

Interacting miRNAs (#binding sites)

mmu-miR-15b-5p(1), mmu-miR-298-5p(1), mmu-miR-203-3p(1), mmu-miR-138-5p(1), mmu-miR-339-5p(1), mmu-miR-495-3p(1), mmu-miR-382-3p(1), mmu-miR-411-3p(1), mmu-miR-183-5p(1), mmu-miR-532-5p(1), mmu-miR-7a-1-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TGGAAGGAGACAGCTAAACCAGGTGG

siRNA sets

ACCTGGTTTAGCTGTCTCC, CACCTGGTTTAGCTGTCTC, GTTTAGCTGTCTCCTTCCA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBIRC6_1093_ORF_1

0.7034

0.028114936

0.704731539

657

ORF sequence:

ATGGACAGATTGTCTTACCTCTTGCCCAGTGCACGTCCAGAACTTGGAGTTGGGCCAGGCCGTTCTGTAGACAGGGCATTGATGTATAGTGAAGCTAACAGAAGGGAGACCTTCACTTCGTGGCCTCATGTTGGCTATAGGTGGGCACAGCCAGATCCCATGGCTCAAGCTGGATTTTATCACCAGCCTGCTTCATCTGGAGATGATAGAGCCATGTGTTTTACTTGTAGTGTTTGCCTCGTTTGTTGGGAGCCTACGGATGAACCTTGGTCCGAACATGAGAGACACTCTCCCAACTGTCCCTTTGTGAAGGGTGAGCACACCCAGAATGTGCCCTTGTCAGTCACCCTGGCAACGAGTCCTGCGCAGCTCCCTTCTGCAGATGGAGCTGACAGAATAGCTTGCTTTGGGTCTGGGAGCTGTCCTCAGTTTCTAGCTGCTGCAACCAAACGTGGGAAGATCTGCATATGGGACGTCTCCAAACTCATGAAGGTGCACTTGAAGTTTGAAATTAATGCCTATGACCCAGCAATCGTGCAACAGCTGATCCTATCAGGAGACCCAAGTTCAGGAGTTGATTCAAGGAGACCCACTTTGGCATGGCTGGAAGACTCTTCTAGTTGCTCAGACATACCGAAACTGGAAGGAGACAGCTAA

Peptide sequence:

MDRLSYLLPSARPELGVGPGRSVDRALMYSEANRRETFTSWPHVGYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVKGEHTQNVPLSVTLATSPAQLPSADGADRIACFGSGSCPQFLAAATKRGKICIWDVSKLMKVHLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDS

IRESfinder result

IRESfinder score

0.584895886

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page