top of page

mmu_circBbs9_618

Basic information of circular RNA
PanCircBase ID:

mmu_circBbs9_618

mm39_Chr. Position ID:

chr9|22555040|22582253|+

Gene name:

Bbs9

Transcript:

ENSMUST00000039798.16

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

5

Exon/intron indexes:

13,14,15,16,17

Exon/intron offsets:

0,2219,11480,15305,27040

Genomic length:

27213

Exon/intron sizes in nt:

103,105,141,96,173

Flanking exon/introns:

chr9:22550079-22555040|chr9:22582253-22590207

Splice length:

618

Other database IDs:

circBase: mmu_circ_0015469, CIRCpedia: MMU_CIRCpedia_13586, circAtlas: mmu-Bbs9_0006

circBase: hsa_circ_0134175, circAtlas: hsa-BBS9_0007, CIRCpedia: HSA_CIRCpedia_162992

Human Ortholog IDs:
Mature spliced Sequence:

ATTACCCTGCAGAACCGAGTGGTGTTGCAGAAGGTCAAGCTGTCTATCTATGTGCAGCCTCCACTACAGTTGACTTGTGATCAGTTCACCTTTGACTTCACGGTTCCAGATATGACGAGTTCAGTAGCGTTTTCTGTGTACCTGAAGAGAAACTACACACCATCCGAGTTAGAAGGAAATGCTGTTGTTTCTTACTCCAGACCGACAGGTATTCCTCGGGTTGTCCAATGTAAATTTAGACTTCCTCTGAAACTGATTTGCCTACCTGGTCAGCCTTCAAAAACTGCAAGCCACAAACTAACTATAGACACCAACAAATCTCCTGTCAGTCTGCTCGGTCTCTTCCCAGACTTTGCCAACCCATCAGATGACGACCAAGTGAATGTAATGGGCTTCCGTCTCCTAGGAGGCGCTCGAGTGACTCTTCTTGCTTCCAGAACATCCCAACGATACCGCATTCAGAGCGAACAGTTTGAAGATCTCTGGCTCATAACCAATGAACTCATCCTCCGCCTTCAGGAACATTTTGAAAAACAGGGAACCAAAGACTTTTCGTGTTCTTTTTCTGGGTGTGTGCCCCTTCAAGAATATTTTGAGTTGATTGATCATCATTTTGAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TTCGTGTTCTTTTTCTGGGTGTG

59.87

TCAACTGTAGTGGAGGCTGC

59.68

140

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TTCGTGTTCTTTTTCTGGGTGT

58.65

TCAACTGTAGTGGAGGCTGC

59.68

140

PCR template sequence:

GGAACATTTTGAAAAACAGGGAACCAAAGACTTTTCGTGTTCTTTTTCTGGGTGTGTGCCCCTTCAAGAATATTTTGAGTTGATTGATCATCATTTTGAGATTACCCTGCAGAACCGAGTGGTGTTGCAGAAGGTCAAGCTGTCTATCTATGTGCAGCCTCCACTACAGTTGACTTGTGATCAGTTCACCTTTGACTTCA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

4

Interacting miRNAs (#binding sites)

mmu-miR-9-5p(1), mmu-miR-181b-5p(1), mmu-miR-339-3p(1), mmu-miR-181d-5p(1)

siRNAs for circular RNA silencing
Junction sequence

TCATCATTTTGAGATTACCCTGCAGA

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCBBS9_618_ORF_1

0.8304

0.093193167

0.991604515

1125

ORF sequence:

ATGACGAGTTCAGTAGCGTTTTCTGTGTACCTGAAGAGAAACTACACACCATCCGAGTTAGAAGGAAATGCTGTTGTTTCTTACTCCAGACCGACAGGTATTCCTCGGGTTGTCCAATGTAAATTTAGACTTCCTCTGAAACTGATTTGCCTACCTGGTCAGCCTTCAAAAACTGCAAGCCACAAACTAACTATAGACACCAACAAATCTCCTGTCAGTCTGCTCGGTCTCTTCCCAGACTTTGCCAACCCATCAGATGACGACCAAGTGAATGTAATGGGCTTCCGTCTCCTAGGAGGCGCTCGAGTGACTCTTCTTGCTTCCAGAACATCCCAACGATACCGCATTCAGAGCGAACAGTTTGAAGATCTCTGGCTCATAACCAATGAACTCATCCTCCGCCTTCAGGAACATTTTGAAAAACAGGGAACCAAAGACTTTTCGTGTTCTTTTTCTGGGTGTGTGCCCCTTCAAGAATATTTTGAGTTGATTGATCATCATTTTGAGATTACCCTGCAGAACCGAGTGGTGTTGCAGAAGGTCAAGCTGTCTATCTATGTGCAGCCTCCACTACAGTTGACTTGTGATCAGTTCACCTTTGACTTCACGGTTCCAGATATGACGAGTTCAGTAGCGTTTTCTGTGTACCTGAAGAGAAACTACACACCATCCGAGTTAGAAGGAAATGCTGTTGTTTCTTACTCCAGACCGACAGGTATTCCTCGGGTTGTCCAATGTAAATTTAGACTTCCTCTGAAACTGATTTGCCTACCTGGTCAGCCTTCAAAAACTGCAAGCCACAAACTAACTATAGACACCAACAAATCTCCTGTCAGTCTGCTCGGTCTCTTCCCAGACTTTGCCAACCCATCAGATGACGACCAAGTGAATGTAATGGGCTTCCGTCTCCTAGGAGGCGCTCGAGTGACTCTTCTTGCTTCCAGAACATCCCAACGATACCGCATTCAGAGCGAACAGTTTGAAGATCTCTGGCTCATAACCAATGAACTCATCCTCCGCCTTCAGGAACATTTTGAAAAACAGGGAACCAAAGACTTTTCGTGTTCTTTTTCTGGGTGTGTGCCCCTTCAAGAATATTTTGAGTTGATTGATCATCATTTTGAG

Peptide sequence:

MTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPDFANPSDDDQVNVMGFRLLGGARVTLLASRTSQRYRIQSEQFEDLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFEITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTVPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPDFANPSDDDQVNVMGFRLLGGARVTLLASRTSQRYRIQSEQFEDLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFE

IRESfinder result

IRESfinder score

0.801000565

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page