top of page

mmu_circB830012L14Rik_483

Basic information of circular RNA
PanCircBase ID:

mmu_circB830012L14Rik_483

mm39_Chr. Position ID:

chr12|109652831|109659393|+

Gene name:

B830012L14Rik

Transcript:

ENSMUST00000238801.2

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

9,10,11,12,13,14

Exon/intron offsets:

0,552,1270,2686,3565,6468

Genomic length:

6562

Exon/intron sizes in nt:

78,114,74,76,47,94

Flanking exon/introns:

chr12:109651634-109652831|chr12:109659393-109662488

Splice length:

483

Other database IDs:

circAtlas: mmu-Gm25224_0002

Human Ortholog IDs:
Mature spliced Sequence:

GTGGACCATCTAATTAGAGGACCCTCCAATGGTCAAGCACTCTATTTGCACCAGCTTGAGGAGACGAACAAGACCAGTAATGGACTTTCCCAAGGTATCTATTCACCTCCAATGGCTTCCAGCCCTTCAGTTGCTCGTGATGATGTGAGATCTGCCCAAACTTCTCCTCATAGTTTTGATGGTTTGATGAAGGTGTTTGCTGCCTGGAGGAGGTCTCCATGTCTAGGATCTCCGCTGATGTCATGGGTGGTGCTGGGCTGACCAGTTGAAGGAACGATGTTACTGAAGAGTCTGCCATGGTCAAGGGCTCTGTGCTTTCCCAAGAAGAAGTTCATGTTGAATAGTAGAGCAATGGGAAGAGAGTTCCTTATTCACACCTGGGGTTTAAGTACAGCGGATGCATGCAGCTCCTCTCATCATGGATACTTCAGGATGAAGGTCACAACACTCACTGCATGGCTGGGCCAGTACAGACCTCAATGA

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GCATGCAGCTCCTCTCATCA

60.18

GTCTCCTCAAGCTGGTGCAA

60.25

149

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCATGCAGCTCCTCTCATC

60.18

GTCTCCTCAAGCTGGTGCAA

60.25

150

PCR template sequence:

TTTAAGTACAGCGGATGCATGCAGCTCCTCTCATCATGGATACTTCAGGATGAAGGTCACAACACTCACTGCATGGCTGGGCCAGTACAGACCTCAATGAGTGGACCATCTAATTAGAGGACCCTCCAATGGTCAAGCACTCTATTTGCACCAGCTTGAGGAGACGAACAAGACCAGTAATGGACTTTCCCAAGGTATCT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

10

Interacting miRNAs (#binding sites)

mmu-miR-375-3p(1), mmu-miR-19b-3p(1), mmu-miR-205-5p(1), mmu-miR-29b-3p(1), mmu-miR-29a-3p(1), mmu-miR-29c-3p(1), mmu-miR-19a-3p(1), mmu-miR-758-3p(1), mmu-miR-802-5p(1), mmu-miR-193b-3p(1)

siRNAs for circular RNA silencing
Junction sequence

CAGACCTCAATGAGTGGACCATCTAA

siRNA sets

ATGGTCCACTCATTGAGGT,TGGTCCACTCATTGAGGTC,GTCCACTCATTGAGGTCTG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCB830012L14RIK_483_ORF_1

0.7054

-0.106914203

0.052289157

207

ORF sequence:

ATGTTACTGAAGAGTCTGCCATGGTCAAGGGCTCTGTGCTTTCCCAAGAAGAAGTTCATGTTGAATAGTAGAGCAATGGGAAGAGAGTTCCTTATTCACACCTGGGGTTTAAGTACAGCGGATGCATGCAGCTCCTCTCATCATGGATACTTCAGGATGAAGGTCACAACACTCACTGCATGGCTGGGCCAGTACAGACCTCAATGA

Peptide sequence:

MLLKSLPWSRALCFPKKKFMLNSRAMGREFLIHTWGLSTADACSSSHHGYFRMKVTTLTAWLGQYRPQ

IRESfinder result

IRESfinder score

0.539024773

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page