top of page

mmu_circB830012L14Rik_1070

Basic information of circular RNA
PanCircBase ID:

mmu_circB830012L14Rik_1070

mm39_Chr. Position ID:

chr12|109647626|109659393|+

Gene name:

B830012L14Rik

Transcript:

ENSMUST00000238801.2

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

12

Exon/intron indexes:

3,4,5,6,7,8,9,10,11,12,13,14

Exon/intron offsets:

0,841,1541,2506,3412,3926,5205,5757,6475,7891,8770,11673

Genomic length:

11767

Exon/intron sizes in nt:

128,129,127,80,41,82,78,114,74,76,47,94

Flanking exon/introns:

chr12:109647003-109647626|chr12:109659393-109662488

Splice length:

1070

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

AGAGCTGACCCAAGTGATATGAGAAGTTTGCTGTGATGGACAGTTTCTGGGTGCTTTGCCAACAATCCAGAGTACATGGTGACATGTCAACTCCAGCTGTGATCCTCCTGTGTGGCACTGACTTACAGAAATGGCGACCCAACAGATGGTACCAGCATGCTGAGATATAGAACCACCCTTGTATCACCACTGTGACATCTCAGAGCTTTGCCGACCAAGAGGCAACATCTTGATCTTCCTTGCCCACCAGCTTGCAGGAAGGTGACTCTAGTGATGGTAGAGTTATGGATAATGGACAATTCCTGGGATGCCATGGCAACAGTCCACAGCCCATGGTGACTTGTCAACTCCAGCTCTGTTCCTTCTGTGCGCACCTGCTTATAGAGGCTGATTGACTGATGTCATTGCAAAAGTTTCCTGTCATAGAGAGTTCCTCTGATGTCCCTTCAGCACCACTACAACTGAGCTGACTGCAGGATTTCCTATGTTTAATGACTGCCTCAAGAATGTGTGCTCCTAGGCTGATGTCTGCATTTTCTATGATCAGCAGTGGAACATTTGCACCTCTGCATTGAACATGGGGCAGTGTGGACCATCTAATTAGAGGACCCTCCAATGGTCAAGCACTCTATTTGCACCAGCTTGAGGAGACGAACAAGACCAGTAATGGACTTTCCCAAGGTATCTATTCACCTCCAATGGCTTCCAGCCCTTCAGTTGCTCGTGATGATGTGAGATCTGCCCAAACTTCTCCTCATAGTTTTGATGGTTTGATGAAGGTGTTTGCTGCCTGGAGGAGGTCTCCATGTCTAGGATCTCCGCTGATGTCATGGGTGGTGCTGGGCTGACCAGTTGAAGGAACGATGTTACTGAAGAGTCTGCCATGGTCAAGGGCTCTGTGCTTTCCCAAGAAGAAGTTCATGTTGAATAGTAGAGCAATGGGAAGAGAGTTCCTTATTCACACCTGGGGTTTAAGTACAGCGGATGCATGCAGCTCCTCTCATCATGGATACTTCAGGATGAAGGTCACAACACTCACTGCATGGCTGGGCCAGTACAGACCTCAATGA

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GCATGCAGCTCCTCTCATCA

60.18

GGCAAAGCACCCAGAAACTG

59.97

144

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCATGCAGCTCCTCTCATC

60.18

GGCAAAGCACCCAGAAACTG

59.97

145

PCR template sequence:

TTTAAGTACAGCGGATGCATGCAGCTCCTCTCATCATGGATACTTCAGGATGAAGGTCACAACACTCACTGCATGGCTGGGCCAGTACAGACCTCAATGAAGAGCTGACCCAAGTGATATGAGAAGTTTGCTGTGATGGACAGTTTCTGGGTGCTTTGCCAACAATCCAGAGTACATGGTGACATGTCAACTCCAGCTGT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

18

Interacting miRNAs (#binding sites)

mmu-miR-19b-3p(2), mmu-miR-19a-3p(2), mmu-miR-27b-3p(1), mmu-miR-27a-3p(1), mmu-miR-375-3p(1), mmu-miR-205-5p(1), mmu-miR-29b-3p(1), mmu-miR-29a-3p(1), mmu-miR-29c-3p(1), mmu-miR-298-5p(1), mmu-miR-324-5p(1), mmu-miR-381-3p(1), mmu-miR-758-3p(1), mmu-miR-324-3p(1), mmu-miR-224-5p(1), mmu-miR-802-5p(1), mmu-miR-673-5p(1), mmu-miR-193b-3p(1)

siRNAs for circular RNA silencing
Junction sequence

CAGACCTCAATGAAGAGCTGACCCAA

siRNA sets

TTGGGTCAGCTCTTCATTG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCB830012L14RIK_1070_ORF_2

0.7054

-0.106914203

0.050946429

207

ORF sequence:

ATGTTACTGAAGAGTCTGCCATGGTCAAGGGCTCTGTGCTTTCCCAAGAAGAAGTTCATGTTGAATAGTAGAGCAATGGGAAGAGAGTTCCTTATTCACACCTGGGGTTTAAGTACAGCGGATGCATGCAGCTCCTCTCATCATGGATACTTCAGGATGAAGGTCACAACACTCACTGCATGGCTGGGCCAGTACAGACCTCAATGA

Peptide sequence:

MLLKSLPWSRALCFPKKKFMLNSRAMGREFLIHTWGLSTADACSSSHHGYFRMKVTTLTAWLGQYRPQ

IRESfinder result

IRESfinder score

0.526224664

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page