top of page

mmu_circAtg16l2_1657

Basic information of circular RNA
PanCircBase ID:

mmu_circAtg16l2_1657

mm39_Chr. Position ID:

chr7|100939376|100949418|-

Gene name:

Atg16l2

Transcript:

ENSMUST00000120267.9

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

16

Exon/intron indexes:

17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

Exon/intron offsets:

0,193,412,1317,1709,1938,2184,3203,3706,4689,5951,6338,6587,6990,8836,9942

Genomic length:

10042

Exon/intron sizes in nt:

102,48,150,106,121,72,71,106,109,63,114,66,252,74,103,100

Flanking exon/introns:

chr7:100939141-100939376|chr7:100949418-100951107

Splice length:

1657

Other database IDs:

circAtlas: mmu-Atg16l2_0001

Human Ortholog IDs:
Mature spliced Sequence:

ATAACCATCTCCTAGAGAAGGCTGAACTGCTAGCCAAGTTCTCAGAAAAGTTGAAGTCCGAACCAAAGGATGCCATCTCCACCCGACATGAGGACTGGAGGGAGGAGGTCTCAGGGACAGGCCCTGACCAAGTCTCATCACCAGCCTCTCTGAGGGTGAAGTGGCAGCAGGAGAAGAAGGGGCTGCAGCTGGTCTGTGGTGAGATGGCCTACCAGGTGGTGAAGAAGAGCGCAGCCCTAGACACCCTGCAGTCACAGCTGGAGGAGCGGCAGGACAGGTTGGAAGCCCTGCAGGCCTGCGTGGTGCAGCTACAGGAGGCGCGGGCTCAGCAGTCCCGGCAGCTGGAGGAACGGCAAGCGGAGAACGCAGCACAGAGAGAAGCCTATGAGACGCTGCTCCAGCAAGCTGTGCACCAGGAGGCGGCACTGCGCAGGCTCCAGGAAGAGGCACGCGACTTGCTGGAGCAGCTTGTGCAGCGTAAGGCGCGCGCCGCCGCTGAGCGCAATCTACGTAATGAGCGTAGAGAGAGGGCCAACCAGGCTCTGGTGTCCCAGGAGCTGAAGAAAGCGGCTAAGCGGACTGTGAGCATCAGCGAGATCCCAAACACTCTAGAAGATGGGACGAAAGAAGAGACTGTGGCTCTAGCTCCTGCCGCTCTGCCTGAGTTCTCAGAGAGTGAGACTTGTGAAAAATGGAAGAGGCCTTTCAGGTCTGCCTCGGCCACCTCCCTGACACTGTCCCGCTGTGTGGATGTGGTGAAGGGGCTGTTGGACTTCAAGAAAAGAAGAGGTCACTCGGTTGGGGGCGCACCTGAGCAGCGGTACCAAAGCATCCCTGTGTGTGTGTCTGCCCAAATTCCCTCCCAGGCTCAGGATGTCTTGGATGCCCATCTCTCTGAGGTCAATGCTGTTTGTTTTGGCCCCAACAGCAGCCTCCTGGCCACTGGAGGGGCTGACCGGCTGATCCACCTCTGGAATGTTGTAGGAGGTCGCCTGGAGGCCAACCAGACCCTGGAAGGAGCTGGCGGCAGCATCACCAGTGTGGATTTTGACCCCTCAGGCTCCCAGGTTTTGGCAGCTACTTACAACCAGGCTGCCCAGCTCTGGAAGGTGGGAGAGACTCAGTCCAAGGAAACATTGTCCGGACACAAGGACAAAGTGACTGCTGCCAAATTCAAGCTAACAAGGCACCAGGCAGTGACTGGGAGCCGAGACCGGACAGTGAAGGAGTGGGACCTGGGCCGCGCCTACTGTTCCAGGACTATCAATGTACTTTCCTACTGCAATGACGTGGTGTGCGGGGACCACATCATCATCAGTGGCCACAATGACCAAAAGATCCGGTTCTGGGACAGCAGGGGCCCTCACTGCATCCAGGTCATCCCCGTGCAGGGCCGGGTTACCTCCCTGCACCTCAGCTATGACCAGCTGCATCTGCTTAGCTGTTCCCGAGACAACACACTCAAGGTTATCGACCTGCGAATCAGCAATATCCGACAGGTGTTCAGGGCAGATGGCTTCAAGTGCAGTTCTGACTGGACCAAAGCTGTGTTCAGCCCTGACAGAAGCTATGCACTGGCAGGCTCTTCAAACGGCGACCTGTACATCTGGGATGTGAACACCGGGAAACTGGAGACCAGCCTACAGGGACCCCACTG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TTCAAACGGCGACCTGTACA

59.9

TCCTCATGTCGGGTGGAGAT

60.03

166

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

AACGGCGACCTGTACATCTG

60.11

TCCTCATGTCGGGTGGAGAT

60.03

162

PCR template sequence:

CTGACAGAAGCTATGCACTGGCAGGCTCTTCAAACGGCGACCTGTACATCTGGGATGTGAACACCGGGAAACTGGAGACCAGCCTACAGGGACCCCACTGATAACCATCTCCTAGAGAAGGCTGAACTGCTAGCCAAGTTCTCAGAAAAGTTGAAGTCCGAACCAAAGGATGCCATCTCCACCCGACATGAGGACTGGAG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

21

Interacting miRNAs (#binding sites)

mmu-miR-9-5p(2), mmu-miR-27b-3p(1), mmu-miR-27a-3p(1), mmu-miR-20a-5p(1), mmu-miR-328-3p(1), mmu-miR-709(1), mmu-miR-125b-5p(1), mmu-miR-138-5p(1), mmu-miR-495-3p(1), mmu-miR-363-3p(1), mmu-miR-125a-5p(1), mmu-miR-370-3p(1), mmu-miR-324-3p(1), mmu-miR-207(1), mmu-miR-673-5p(1), mmu-miR-5101(1), mmu-miR-669d-5p(1), mmu-miR-452-3p(1), mmu-miR-697(1), mmu-miR-490-3p(1), mmu-miR-574-5p(1)

siRNAs for circular RNA silencing
Junction sequence

AGGGACCCCACTGATAACCATCTCCT

siRNA sets

ATGGTTATCAGTGGGGTCC, TGGTTATCAGTGGGGTCCC, GATGGTTATCAGTGGGGTC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCATG16L2_1657_ORF_1

1.0514

0.420616512

0.999857231

1455

ORF sequence:

ATGGCCTACCAGGTGGTGAAGAAGAGCGCAGCCCTAGACACCCTGCAGTCACAGCTGGAGGAGCGGCAGGACAGGTTGGAAGCCCTGCAGGCCTGCGTGGTGCAGCTACAGGAGGCGCGGGCTCAGCAGTCCCGGCAGCTGGAGGAACGGCAAGCGGAGAACGCAGCACAGAGAGAAGCCTATGAGACGCTGCTCCAGCAAGCTGTGCACCAGGAGGCGGCACTGCGCAGGCTCCAGGAAGAGGCACGCGACTTGCTGGAGCAGCTTGTGCAGCGTAAGGCGCGCGCCGCCGCTGAGCGCAATCTACGTAATGAGCGTAGAGAGAGGGCCAACCAGGCTCTGGTGTCCCAGGAGCTGAAGAAAGCGGCTAAGCGGACTGTGAGCATCAGCGAGATCCCAAACACTCTAGAAGATGGGACGAAAGAAGAGACTGTGGCTCTAGCTCCTGCCGCTCTGCCTGAGTTCTCAGAGAGTGAGACTTGTGAAAAATGGAAGAGGCCTTTCAGGTCTGCCTCGGCCACCTCCCTGACACTGTCCCGCTGTGTGGATGTGGTGAAGGGGCTGTTGGACTTCAAGAAAAGAAGAGGTCACTCGGTTGGGGGCGCACCTGAGCAGCGGTACCAAAGCATCCCTGTGTGTGTGTCTGCCCAAATTCCCTCCCAGGCTCAGGATGTCTTGGATGCCCATCTCTCTGAGGTCAATGCTGTTTGTTTTGGCCCCAACAGCAGCCTCCTGGCCACTGGAGGGGCTGACCGGCTGATCCACCTCTGGAATGTTGTAGGAGGTCGCCTGGAGGCCAACCAGACCCTGGAAGGAGCTGGCGGCAGCATCACCAGTGTGGATTTTGACCCCTCAGGCTCCCAGGTTTTGGCAGCTACTTACAACCAGGCTGCCCAGCTCTGGAAGGTGGGAGAGACTCAGTCCAAGGAAACATTGTCCGGACACAAGGACAAAGTGACTGCTGCCAAATTCAAGCTAACAAGGCACCAGGCAGTGACTGGGAGCCGAGACCGGACAGTGAAGGAGTGGGACCTGGGCCGCGCCTACTGTTCCAGGACTATCAATGTACTTTCCTACTGCAATGACGTGGTGTGCGGGGACCACATCATCATCAGTGGCCACAATGACCAAAAGATCCGGTTCTGGGACAGCAGGGGCCCTCACTGCATCCAGGTCATCCCCGTGCAGGGCCGGGTTACCTCCCTGCACCTCAGCTATGACCAGCTGCATCTGCTTAGCTGTTCCCGAGACAACACACTCAAGGTTATCGACCTGCGAATCAGCAATATCCGACAGGTGTTCAGGGCAGATGGCTTCAAGTGCAGTTCTGACTGGACCAAAGCTGTGTTCAGCCCTGACAGAAGCTATGCACTGGCAGGCTCTTCAAACGGCGACCTGTACATCTGGGATGTGAACACCGGGAAACTGGAGACCAGCCTACAGGGACCCCACTGA

Peptide sequence:

MAYQVVKKSAALDTLQSQLEERQDRLEALQACVVQLQEARAQQSRQLEERQAENAAQREAYETLLQQAVHQEAALRRLQEEARDLLEQLVQRKARAAAERNLRNERRERANQALVSQELKKAAKRTVSISEIPNTLEDGTKEETVALAPAALPEFSESETCEKWKRPFRSASATSLTLSRCVDVVKGLLDFKKRRGHSVGGAPEQRYQSIPVCVSAQIPSQAQDVLDAHLSEVNAVCFGPNSSLLATGGADRLIHLWNVVGGRLEANQTLEGAGGSITSVDFDPSGSQVLAATYNQAAQLWKVGETQSKETLSGHKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVCGDHIIISGHNDQKIRFWDSRGPHCIQVIPVQGRVTSLHLSYDQLHLLSCSRDNTLKVIDLRISNIRQVFRADGFKCSSDWTKAVFSPDRSYALAGSSNGDLYIWDVNTGKLETSLQGPH

IRESfinder result

IRESfinder score

0.294487666

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page