top of page

mmu_circAtf2_146

Basic information of circular RNA
PanCircBase ID:

mmu_circAtf2_146

mm39_Chr. Position ID:

chr2|73693512|73704089|-

Gene name:

Atf2

Transcript:

ENSMUST00000112010.9

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

4,3

Exon/intron offsets:

0,10501

Genomic length:

10577

Exon/intron sizes in nt:

70,76

Flanking exon/introns:

chr2:73681326-73693512|chr2:73704089-73710628

Splice length:

146

Other database IDs:

circAtlas: mmu-Atf2_0056

CIRCpedia: HSA_CIRCpedia_352977

Human Ortholog IDs:
Mature spliced Sequence:

TGTCTTTGCCATGAAACAGAGGACATGATAAACTGTTTACCTTAATGAAATTCAAGTTGCATGTGAATTCTGCCAGATAAAACACGGACCTGTGGAATATGAGTGATGACAAACCCTTTCTATGCACTGCCCCTGGGTGTGGCCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

ACGGACCTGTGGAATATGAGTG

59.83

GCAGAATTCACATGCAACTTGA

58.1

136

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CACGGACCTGTGGAATATGAGT

59.83

GCAGAATTCACATGCAACTTGA

58.1

137

PCR template sequence:

CAGATAAAACACGGACCTGTGGAATATGAGTGATGACAAACCCTTTCTATGCACTGCCCCTGGGTGTGGCCAGTGTCTTTGCCATGAAACAGAGGACATGATAAACTGTTTACCTTAATGAAATTCAAGTTGCATGTGAATTCTGC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

4

Interacting miRNAs (#binding sites)

mmu-miR-34a-5p(1), mmu-miR-152-3p(1), mmu-miR-148b-3p(1), mmu-miR-148a-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TGGGTGTGGCCAGTGTCTTTGCCATG

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCATF2_146_ORF_1

0.6416

-0.218115797

0.013687718

93

ORF sequence:

ATGAGTGATGACAAACCCTTTCTATGCACTGCCCCTGGGTGTGGCCAGTGTCTTTGCCATGAAACAGAGGACATGATAAACTGTTTACCTTAA

Peptide sequence:

MSDDKPFLCTAPGCGQCLCHETEDMINCLP

IRESfinder result

IRESfinder score

0.670451792

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page