top of page

mmu_circAscc3_772

Basic information of circular RNA
PanCircBase ID:

mmu_circAscc3_772

mm39_Chr. Position ID:

chr10|50643186|50718386|+

Gene name:

Ascc3

Transcript:

ENSMUST00000035606.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

5

Exon/intron indexes:

35,36,37,38,39

Exon/intron offsets:

0,282,56545,73207,75052

Genomic length:

75200

Exon/intron sizes in nt:

11,21,35,22,51,52,148

Flanking exon/introns:

chr10:50630218-50643186|chr10:50718386-50721626

Splice length:

772

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

CTACTACAGCTTGGGTGACGTCAGCCAGGACTCCATAAACAAGTTCCTGTCACATCTGATTGGGCAGTCTCTGGTTGAATTGGAGCTTTCCCACTGCATTGAAGTTGGAGAGGATAATCGCACCATTGAACCACTGACATGTGGTCGAATTGCCTCCTATTACTATTTGAAGCACAAAACTGTCAAAATGTTCAAGGACCGTTTGAAACCTGAGTGCAGCACTGAGGAACTGCTGTCAATTCTGAGTGATGCAGAAGAATACACAGACTTACCAGTAAGACACAATGAGGACCATACGAATAATGAATTGGCCAAATGTCTTCCCATTGAATTAAATCCTCATTCATTTGACAGCCCTCACACCAAAGCCCATCTCTTGCTTCAAGCGCATCTCAGCCGAGCCATGCTGCCCTGCCCAGATTATGATACTGATACCAAAACAGTCTTAGACCAAGCTCTCAGAGTATGCCAGGCAATGCTGGATGTGGCTGCAAGCCAGGGATGGCTAGTGACCGTCCTGAATATCACCCACCTGATTCAGATGGTGATCCAAGGCCGATGGCTCAAGGACTCTTCTCTTCTCACAATACCAAACATAGAGCAGCACCACCTTCACCTTTTCAGGAAATGGAAGCCACCTGTAAAGAGCTCACATGCTAAGTGCCGAACATCCATTGAGTGCCTTCCTGAGCTGATCCATGCCTGTGAAGGGAAGGACCATGTGTTCAGCTCCATGGTAGAGAAAGAGTTACAGCCTGCAAAAACAAAGCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GGACCATGTGTTCAGCTCCA

59.96

TGCAGTGGGAAAGCTCCAAT

59.89

156

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GGACCATGTGTTCAGCTCCA

59.96

ATGCAGTGGGAAAGCTCCAA

59.89

157

PCR template sequence:

CATTGAGTGCCTTCCTGAGCTGATCCATGCCTGTGAAGGGAAGGACCATGTGTTCAGCTCCATGGTAGAGAAAGAGTTACAGCCTGCAAAAACAAAGCAGCTACTACAGCTTGGGTGACGTCAGCCAGGACTCCATAAACAAGTTCCTGTCACATCTGATTGGGCAGTCTCTGGTTGAATTGGAGCTTTCCCACTGCATT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

6

Interacting miRNAs (#binding sites)

mmu-miR-124-3p(1), mmu-miR-7b-5p(1), mmu-miR-103-3p(1), mmu-miR-7a-5p(1), mmu-miR-107-3p(1), mmu-miR-129-5p(1)

siRNAs for circular RNA silencing
Junction sequence

AAAAACAAAGCAGCTACTACAGCTTG

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCASCC3_772_ORF_1

1.012

0.147661901

0.826056534

603

ORF sequence:

ATGTTCAAGGACCGTTTGAAACCTGAGTGCAGCACTGAGGAACTGCTGTCAATTCTGAGTGATGCAGAAGAATACACAGACTTACCAGTAAGACACAATGAGGACCATACGAATAATGAATTGGCCAAATGTCTTCCCATTGAATTAAATCCTCATTCATTTGACAGCCCTCACACCAAAGCCCATCTCTTGCTTCAAGCGCATCTCAGCCGAGCCATGCTGCCCTGCCCAGATTATGATACTGATACCAAAACAGTCTTAGACCAAGCTCTCAGAGTATGCCAGGCAATGCTGGATGTGGCTGCAAGCCAGGGATGGCTAGTGACCGTCCTGAATATCACCCACCTGATTCAGATGGTGATCCAAGGCCGATGGCTCAAGGACTCTTCTCTTCTCACAATACCAAACATAGAGCAGCACCACCTTCACCTTTTCAGGAAATGGAAGCCACCTGTAAAGAGCTCACATGCTAAGTGCCGAACATCCATTGAGTGCCTTCCTGAGCTGATCCATGCCTGTGAAGGGAAGGACCATGTGTTCAGCTCCATGGTAGAGAAAGAGTTACAGCCTGCAAAAACAAAGCAGCTACTACAGCTTGGGTGA

Peptide sequence:

MFKDRLKPECSTEELLSILSDAEEYTDLPVRHNEDHTNNELAKCLPIELNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAASQGWLVTVLNITHLIQMVIQGRWLKDSSLLTIPNIEQHHLHLFRKWKPPVKSSHAKCRTSIECLPELIHACEGKDHVFSSMVEKELQPAKTKQLLQLG

IRESfinder result

IRESfinder score

0.594269352

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page