top of page

mmu_circArih1_216

Basic information of circular RNA
PanCircBase ID:

mmu_circArih1_216

mm39_Chr. Position ID:

chr9|59322052|59333989|-

Gene name:

Arih1

Transcript:

ENSMUST00000171975.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

6,5,4

Exon/intron offsets:

0,11353,11844

Genomic length:

11937

Exon/intron sizes in nt:

67,56,93

Flanking exon/introns:

chr9:59319814-59322052|chr9:59333989-59344053

Splice length:

216

Other database IDs:

CIRCpedia: MMU_CIRCpedia_225824, circAtlas: mmu-Arih1_0021

circBase: hsa_circ_0036224, circAtlas: hsa-ARIH1_0013, CIRCpedia: HSA_CIRCpedia_15574

Human Ortholog IDs:
Mature spliced Sequence:

TATTTTACTGGCCTTGAATGTGGACATAAGTTTTGTATGCAGTGCTGGAGTGAATATTTAACTACAAAAATAATGGAGGAAGGCATGGGGCAGACTATTTCGTGTCCTGCGCATGGTTGTGATATCTTAGTGGATGACAACACAGTTATGCGCCTGATCACAGATTCCAAAGTTAAGTTAAAATATCAACATTTAATAACAAATAGCTTTGTAGAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GCGCCTGATCACAGATTCCA

60.46

ATAGTCTGCCCCATGCCTTC

59.52

165

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCGCCTGATCACAGATTCC

60.46

ATAGTCTGCCCCATGCCTTC

59.52

166

PCR template sequence:

TTGTGATATCTTAGTGGATGACAACACAGTTATGCGCCTGATCACAGATTCCAAAGTTAAGTTAAAATATCAACATTTAATAACAAATAGCTTTGTAGAGTATTTTACTGGCCTTGAATGTGGACATAAGTTTTGTATGCAGTGCTGGAGTGAATATTTAACTACAAAAATAATGGAGGAAGGCATGGGGCAGACTATTT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-181a-5p(1), mmu-miR-217-5p(1), mmu-miR-136-5p(1)

siRNAs for circular RNA silencing
Junction sequence

TAGCTTTGTAGAGTATTTTACTGGCC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCARIH1_216_ORF_1

0.6532

-0.10310814

0.16764448

396

ORF sequence:

ATGCAGTGCTGGAGTGAATATTTAACTACAAAAATAATGGAGGAAGGCATGGGGCAGACTATTTCGTGTCCTGCGCATGGTTGTGATATCTTAGTGGATGACAACACAGTTATGCGCCTGATCACAGATTCCAAAGTTAAGTTAAAATATCAACATTTAATAACAAATAGCTTTGTAGAGTATTTTACTGGCCTTGAATGTGGACATAAGTTTTGTATGCAGTGCTGGAGTGAATATTTAACTACAAAAATAATGGAGGAAGGCATGGGGCAGACTATTTCGTGTCCTGCGCATGGTTGTGATATCTTAGTGGATGACAACACAGTTATGCGCCTGATCACAGATTCCAAAGTTAAGTTAAAATATCAACATTTAATAACAAATAGCTTTGTAGAG

Peptide sequence:

MQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVEYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVE

IRESfinder result

IRESfinder score

0.800300741

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page