top of page

mmu_circArhgap5_145

Basic information of circular RNA
PanCircBase ID:

mmu_circArhgap5_145

mm39_Chr. Position ID:

chr12|52589274|52589419|+

Gene name:

Arhgap5

Transcript:

ENSMUST00000217820.2

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

1

Exon/intron indexes:

2

Exon/intron offsets:

0

Genomic length:

145

Exon/intron sizes in nt:

145

Flanking exon/introns:

chr12:52551170-52589274|chr12:52589419-52604271

Splice length:

145

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

AAAAAGAAAACTAAGACCTTCAACCCACCAACACGTAGAAATTGGGAAAGTAATTACTTTGGGATGCCCCTCCAGGATCTGGTTACAGCTGAGAAGCCTATACCACTATTTGTTGAAAAATGTGTGGAATTTATTGAAGACACAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

ATCTGGTTACAGCTGAGAAGCC

60.09

ACTTTCCCAATTTCTACGTGTTGG

59.72

120

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TCTGGTTACAGCTGAGAAGCC

59.72

GGGCATCCCAAAGTAATTACT

55.61

137

PCR template sequence:

AGGATCTGGTTACAGCTGAGAAGCCTATACCACTATTTGTTGAAAAATGTGTGGAATTTATTGAAGACACAGAAAAAGAAAACTAAGACCTTCAACCCACCAACACGTAGAAATTGGGAAAGTAATTACTTTGGGATGCCCCTC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

1

Interacting miRNAs (#binding sites)

mmu-miR-324-5p(1)

siRNAs for circular RNA silencing
Junction sequence

ATTGAAGACACAGAAAAAGAAAACTA

siRNA sets

TTTTCTTTTTCTGTGTCTT, TTCTTTTTCTGTGTCTTCA, AGTTTTCTTTTTCTGTGTC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCARHGAP5_145_ORF_1

1.0844

-0.016313985

0.06867521

96

ORF sequence:

ATGCCCCTCCAGGATCTGGTTACAGCTGAGAAGCCTATACCACTATTTGTTGAAAAATGTGTGGAATTTATTGAAGACACAGAAAAAGAAAACTAA

Peptide sequence:

MPLQDLVTAEKPIPLFVEKCVEFIEDTEKEN

IRESfinder result

IRESfinder score

0.735596268

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page