top of page

mmu_circArhgap12_565

Basic information of circular RNA
PanCircBase ID:

mmu_circArhgap12_565

mm39_Chr. Position ID:

chr18|6033140|6052923|-

Gene name:

Arhgap12

Transcript:

ENSMUST00000182066.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

11,10,9,8,7,6

Exon/intron offsets:

0,1309,3877,6213,16136,19721

Genomic length:

19783

Exon/intron sizes in nt:

117,103,99,102,82,62

Flanking exon/introns:

chr18:6031828-6033140|chr18:6052923-6057516

Splice length:

565

Other database IDs:

circBase: hsa_circ_0093515, circAtlas: hsa-ARHGAP12_0033, CIRCpedia: HSA_CIRCpedia_75967

Human Ortholog IDs:
Mature spliced Sequence:

GGTCAGGAGAAATATGGACTGTTAAATGTAACAAAAATTACTGAAAATGGGAAAAAAGTTCGAAAGAACTGGTTGTCTTCTTGGGCAGTGCTGCAGGGTTCGTCTTTACTTTTTACGAAAACTCAAGGAAGTAGTACAAGCTGGTTTGGGAGTAATCAGTCCAAACCAGAATTCACAGTGGACCTGAAGGGGGCAGTGATTGAAATGGCATCAAAGGACAAATCGAGCAAGAAGAATGTATTTGAGCTGAAAACTCGACAAGGAACAGAACTGCTAATTCAGTCTGATAATGATGCTGTTATTAATGATTGGTTTAAAGTTCTTAGTAGTACTATCAATAACCAGGTAGCAGAGGCCGATGAAGCAGCTGAAGAGGAAACACCAGATTCACCAGGGGTAGAAAAGCATGATAAAGAAAAGGACCAGAAGGAGCTTAAAAAACTTCGCTCAATGAAAGGATCCAGCATGGATTCTTCAGAGCAGAAGAAAACTAAGAAAAACTTAAAGAAGTTTCTTACCCGGCGCCCCACTTTGCAAGCTGTTCGTGAGAAAGGTTATATCAAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

AGAAGTTTCTTACCCGGCGC

60.67

AGCACTGCCCAAGAAGACAA

59.82

152

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

AGAAGTTTCTTACCCGGCGC

60.67

GCACTGCCCAAGAAGACAAC

59.69

151

PCR template sequence:

ATGGATTCTTCAGAGCAGAAGAAAACTAAGAAAAACTTAAAGAAGTTTCTTACCCGGCGCCCCACTTTGCAAGCTGTTCGTGAGAAAGGTTATATCAAAGGGTCAGGAGAAATATGGACTGTTAAATGTAACAAAAATTACTGAAAATGGGAAAAAAGTTCGAAAGAACTGGTTGTCTTCTTGGGCAGTGCTGCAGGGTT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-324-3p(2), mmu-miR-150-5p(1), mmu-miR-1904(1)

siRNAs for circular RNA silencing
Junction sequence

GGTTATATCAAAGGGTCAGGAGAAAT

siRNA sets

ATTTCTCCTGACCCTTTGA, TTTCTCCTGACCCTTTGAT, CTGACCCTTTGATATAACC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCARHGAP12_565_ORF_1

1.0524

0.150738941

0.556380724

405

ORF sequence:

ATGGCATCAAAGGACAAATCGAGCAAGAAGAATGTATTTGAGCTGAAAACTCGACAAGGAACAGAACTGCTAATTCAGTCTGATAATGATGCTGTTATTAATGATTGGTTTAAAGTTCTTAGTAGTACTATCAATAACCAGGTAGCAGAGGCCGATGAAGCAGCTGAAGAGGAAACACCAGATTCACCAGGGGTAGAAAAGCATGATAAAGAAAAGGACCAGAAGGAGCTTAAAAAACTTCGCTCAATGAAAGGATCCAGCATGGATTCTTCAGAGCAGAAGAAAACTAAGAAAAACTTAAAGAAGTTTCTTACCCGGCGCCCCACTTTGCAAGCTGTTCGTGAGAAAGGTTATATCAAAGGGTCAGGAGAAATATGGACTGTTAAATGTAACAAAAATTACTGA

Peptide sequence:

MASKDKSSKKNVFELKTRQGTELLIQSDNDAVINDWFKVLSSTINNQVAEADEAAEEETPDSPGVEKHDKEKDQKELKKLRSMKGSSMDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKGSGEIWTVKCNKNY

IRESfinder result

IRESfinder score

0.653196285

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page