top of page

mmu_circAptx_756

Basic information of circular RNA
PanCircBase ID:

mmu_circAptx_756

mm39_Chr. Position ID:

chr4|40690968|40697353|-

Gene name:

Aptx

Transcript:

ENSMUST00000068125.11

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

5

Exon/intron indexes:

6,5,4,3,2

Exon/intron offsets:

0,2421,3883,4408,6248

Genomic length:

6385

Exon/intron sizes in nt:

227,60,285,47,137

Flanking exon/introns:

chr4:40688212-40690968|chr4:40697353-40702723

Splice length:

756

Other database IDs:

circAtlas: hsa-APTX_0002, CIRCpedia: HSA_CIRCpedia_63835

Human Ortholog IDs:
Mature spliced Sequence:

AGCTAAGATGCGAGTGTGCTGGTTGGTGAGACAGGACAGCAGGCACCAGCGAATCAAACTTCCCCATTTGGAAGCTGTTGTGATTGGTCGAAGCCCAGAGACCAAGATCACAGATAAGAAATGTTCCCGACAGCAAGTACAGTTGAAAGCAGAGTGTAACAAGGGATATGTCAAAGTACAGCAGATGGGGGTCAACCCCACCAGCATTGACTCGGGCGTCATCGGGAAGGACCAAGAGAAGAAGCTGCTGCCTGGTCAGGTTCTCCACATGGTGAATGGACTTTATCCATACATCGTAGAGTTTGAGGAAGTGGCAGAGAGCCCTAACCTAACACAGAGGAAGAGAAAGAGGTCAGACTGTGATAGTGAGGAGATGGAAGCTGAGTCTGGGACAGGGCTGGCACCTGGGAGCAGCCCCAGCCAGTGCTCTGTGTCCCCTAAGAAGGACAAGAATGGAGCCACCAAAAAGGAATCACTGGGCCACTGGAGTCAAGGCTTGAAGATGTCTATGAAAGACCCCAAAATGCAGGTTTACAAAGACGACCAGGTGGTGGTGATTAAGGATAAATACCCCAAGGCCCGTCACCACTGGCTGGTCTTACCGTGGGCCTCCATTTCCAGTCTGAAGGTTGTGACCAGTGAACACCTTGAACTTCTCAAACATATGCACGCTGTGGGGGAGAAGGTGATAGCAGATTTTGCTGGATCCAGCAAACTGCGCTTCCGATTGGGCTACCATGCCATTCCCAGCATGAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGGGGGAGAAGGTGATAGCA

59.96

TGGGCTTCGACCAATCACAA

59.89

179

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGGGGGAGAAGGTGATAGCA

59.96

GTTTGATTCGCTGGTGCCTG

60.11

141

PCR template sequence:

TCAAACATATGCACGCTGTGGGGGAGAAGGTGATAGCAGATTTTGCTGGATCCAGCAAACTGCGCTTCCGATTGGGCTACCATGCCATTCCCAGCATGAGAGCTAAGATGCGAGTGTGCTGGTTGGTGAGACAGGACAGCAGGCACCAGCGAATCAAACTTCCCCATTTGGAAGCTGTTGTGATTGGTCGAAGCCCAGAG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

4

Interacting miRNAs (#binding sites)

mmu-miR-27b-3p(1), mmu-miR-326-3p(1), mmu-miR-339-5p(1), mmu-miR-136-5p(1)

siRNAs for circular RNA silencing
Junction sequence

TTCCCAGCATGAGAGCTAAGATGCGA

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCAPTX_756_ORF_1

1.1067

0.32264996

0.999869621

1503

ORF sequence:

ATGCGAGTGTGCTGGTTGGTGAGACAGGACAGCAGGCACCAGCGAATCAAACTTCCCCATTTGGAAGCTGTTGTGATTGGTCGAAGCCCAGAGACCAAGATCACAGATAAGAAATGTTCCCGACAGCAAGTACAGTTGAAAGCAGAGTGTAACAAGGGATATGTCAAAGTACAGCAGATGGGGGTCAACCCCACCAGCATTGACTCGGGCGTCATCGGGAAGGACCAAGAGAAGAAGCTGCTGCCTGGTCAGGTTCTCCACATGGTGAATGGACTTTATCCATACATCGTAGAGTTTGAGGAAGTGGCAGAGAGCCCTAACCTAACACAGAGGAAGAGAAAGAGGTCAGACTGTGATAGTGAGGAGATGGAAGCTGAGTCTGGGACAGGGCTGGCACCTGGGAGCAGCCCCAGCCAGTGCTCTGTGTCCCCTAAGAAGGACAAGAATGGAGCCACCAAAAAGGAATCACTGGGCCACTGGAGTCAAGGCTTGAAGATGTCTATGAAAGACCCCAAAATGCAGGTTTACAAAGACGACCAGGTGGTGGTGATTAAGGATAAATACCCCAAGGCCCGTCACCACTGGCTGGTCTTACCGTGGGCCTCCATTTCCAGTCTGAAGGTTGTGACCAGTGAACACCTTGAACTTCTCAAACATATGCACGCTGTGGGGGAGAAGGTGATAGCAGATTTTGCTGGATCCAGCAAACTGCGCTTCCGATTGGGCTACCATGCCATTCCCAGCATGAGAGCTAAGATGCGAGTGTGCTGGTTGGTGAGACAGGACAGCAGGCACCAGCGAATCAAACTTCCCCATTTGGAAGCTGTTGTGATTGGTCGAAGCCCAGAGACCAAGATCACAGATAAGAAATGTTCCCGACAGCAAGTACAGTTGAAAGCAGAGTGTAACAAGGGATATGTCAAAGTACAGCAGATGGGGGTCAACCCCACCAGCATTGACTCGGGCGTCATCGGGAAGGACCAAGAGAAGAAGCTGCTGCCTGGTCAGGTTCTCCACATGGTGAATGGACTTTATCCATACATCGTAGAGTTTGAGGAAGTGGCAGAGAGCCCTAACCTAACACAGAGGAAGAGAAAGAGGTCAGACTGTGATAGTGAGGAGATGGAAGCTGAGTCTGGGACAGGGCTGGCACCTGGGAGCAGCCCCAGCCAGTGCTCTGTGTCCCCTAAGAAGGACAAGAATGGAGCCACCAAAAAGGAATCACTGGGCCACTGGAGTCAAGGCTTGAAGATGTCTATGAAAGACCCCAAAATGCAGGTTTACAAAGACGACCAGGTGGTGGTGATTAAGGATAAATACCCCAAGGCCCGTCACCACTGGCTGGTCTTACCGTGGGCCTCCATTTCCAGTCTGAAGGTTGTGACCAGTGAACACCTTGAACTTCTCAAACATATGCACGCTGTGGGGGAGAAGGTGATAGCAGATTTTGCTGGATCCAGCAAACTGCGCTTCCGATTGGGCTACCATGCCATTCCCAGCATG

Peptide sequence:

MRVCWLVRQDSRHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKGYVKVQQMGVNPTSIDSGVIGKDQEKKLLPGQVLHMVNGLYPYIVEFEEVAESPNLTQRKRKRSDCDSEEMEAESGTGLAPGSSPSQCSVSPKKDKNGATKKESLGHWSQGLKMSMKDPKMQVYKDDQVVVIKDKYPKARHHWLVLPWASISSLKVVTSEHLELLKHMHAVGEKVIADFAGSSKLRFRLGYHAIPSMRAKMRVCWLVRQDSRHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKGYVKVQQMGVNPTSIDSGVIGKDQEKKLLPGQVLHMVNGLYPYIVEFEEVAESPNLTQRKRKRSDCDSEEMEAESGTGLAPGSSPSQCSVSPKKDKNGATKKESLGHWSQGLKMSMKDPKMQVYKDDQVVVIKDKYPKARHHWLVLPWASISSLKVVTSEHLELLKHMHAVGEKVIADFAGSSKLRFRLGYHAIPSM

IRESfinder result

IRESfinder score

0.441055564

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page