top of page

mmu_circAnks1b_201

Basic information of circular RNA
PanCircBase ID:

mmu_circAnks1b_201

mm39_Chr. Position ID:

chr10|90757157|90759464|+

Gene name:

Anks1b

Transcript:

ENSMUST00000183156.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

20,21

Exon/intron offsets:

0,2235

Genomic length:

2307

Exon/intron sizes in nt:

129,72

Flanking exon/introns:

chr10:90733288-90757157|chr10:90759464-90776425

Splice length:

201

Other database IDs:

CIRCpedia: MMU_CIRCpedia_33870, circAtlas: mmu-Anks1b_0023

circBase: hsa_circ_0099676, circAtlas: hsa-SCAF8_0001, CIRCpedia: HSA_CIRCpedia_119262

Human Ortholog IDs:
Mature spliced Sequence:

ACAGGGGACTGGGGAGAACCTTCCATCACCTTGCGACCTCCTAATGAAGCCACAGCCTCAACTCCCGTCCAGTACTGGCAGCATCATCCGGAAAAACTCATCTTCCAGTCATGTGACTACAAAGCCTTTTATTTAGGTTCTATGCTGATAAAAGAGCTGAGGGGGACAGAATCAACACAGGATGCTTGTGCAAAGATGCGG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

AAGAGCTGAGGGGGACAGAA

60.18

CGGATGATGCTGCCAGTACT

59.89

140

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

AAAGAGCTGAGGGGGACAGA

60.18

CGGATGATGCTGCCAGTACT

59.89

141

PCR template sequence:

CTTCCAGTCATGTGACTACAAAGCCTTTTATTTAGGTTCTATGCTGATAAAAGAGCTGAGGGGGACAGAATCAACACAGGATGCTTGTGCAAAGATGCGGACAGGGGACTGGGGAGAACCTTCCATCACCTTGCGACCTCCTAATGAAGCCACAGCCTCAACTCCCGTCCAGTACTGGCAGCATCATCCGGAAAAACTCA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

NA

Interacting miRNAs (#binding sites)

NA

siRNAs for circular RNA silencing
Junction sequence

TGCAAAGATGCGGACAGGGGACTGGG

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANKS1B_201_ORF_1

0.7739

0.154152033

0.214226066

261

ORF sequence:

ATGCTGATAAAAGAGCTGAGGGGGACAGAATCAACACAGGATGCTTGTGCAAAGATGCGGACAGGGGACTGGGGAGAACCTTCCATCACCTTGCGACCTCCTAATGAAGCCACAGCCTCAACTCCCGTCCAGTACTGGCAGCATCATCCGGAAAAACTCATCTTCCAGTCATGTGACTACAAAGCCTTTTATTTAGGTTCTATGCTGATAAAAGAGCTGAGGGGGACAGAATCAACACAGGATGCTTGTGCAAAGATGCGG

Peptide sequence:

MLIKELRGTESTQDACAKMRTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMR

IRESfinder result

IRESfinder score

0.484388013

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page