top of page

mmu_circAnkrd44_795

Basic information of circular RNA
PanCircBase ID:

mmu_circAnkrd44_795

mm39_Chr. Position ID:

chr1|54801419|54831690|-

Gene name:

Ankrd44

Transcript:

ENSMUST00000179030.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

8,7,6,5,4,3

Exon/intron offsets:

0,1384,4089,4523,16026,30192

Genomic length:

30271

Exon/intron sizes in nt:

213,143,88,201,71,79

Flanking exon/introns:

chr1:54792127-54801419|chr1:54831690-54867770

Splice length:

795

Other database IDs:

circAtlas: hsa-ANKRD44_0086

Human Ortholog IDs:
Mature spliced Sequence:

GATTCTGAGAAACGAACCCCGCTTCATGTGGCTGCATTCCTGGGAGATGCAGAGATCATTGAACTCCTGATTTTGTCAGGAGCTCGTGTAAATGCCAAGGACAACATGTGGCTGACCCCACTGCACCGGGCTGTTGCTTCCAGAAGTGAAGAGGCAGTGCAAGTATTGATTAAACACTCGGCTGATGTCAATGCAAGGGACAAGAATTGGCAGACCCCCCTCCATGTGGCAGCAGCCAATAAGGCCGTCAAGTGTGCAGAAGTGATCATTCCACTACTGAGCAGTGTCAATGTCTCCGACAGAGGCGGGCGCACAGCCTTGCACCACGCCGCTCTGAATGGACACATGGAGATGGTCAATTTACTCTTGGCCAAAGGGGCAAACATCAATGCATTTGACAAGAAGGACCGACGAGCTCTCCACTGGGCAGCATACATGGGTCACCTGGACGTTGTGGCGCTGCTCATTAACCATGGTGCAGAAGTTACCTGCAAGGATAAGAAGGGCTACACCCCGCTGCACGCTGCAGCCTCCAATGGGCAGATCAGTGTTGTCAAACATCTCCTGAACCTGGGGGTGGAGATTGATGAAATCAATGTCTATGGAAACACAGCACTTCACATTGCCTGCTACAATGGCCAGGATGCTGTCGTTAATGAGCTGATCGACTATGGTGCTAACGTGAATCAGCCCAACAACAGTGGCTTTACCCCTCTGCACTTTGCAGCGGCGTCTACTCACGGTGCTCTGTGTCTGGAGTTGTTAGTGAACAATGGGGCCGATGTGAACATTCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GGCTTTACCCCTCTGCACTT

59.96

TGCATCTCCCAGGAATGCAG

60.11

144

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GGCTTTACCCCTCTGCACTT

59.96

CTGCATCTCCCAGGAATGCA

60.11

145

PCR template sequence:

CAACAGTGGCTTTACCCCTCTGCACTTTGCAGCGGCGTCTACTCACGGTGCTCTGTGTCTGGAGTTGTTAGTGAACAATGGGGCCGATGTGAACATTCAGGATTCTGAGAAACGAACCCCGCTTCATGTGGCTGCATTCCTGGGAGATGCAGAGATCATTGAACTCCTGATTTTGTCAGGAGCTCGTGTAAATGCCAAGG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

8

Interacting miRNAs (#binding sites)

mmu-miR-200a-3p(1), mmu-miR-141-3p(1), mmu-miR-106b-5p(1), mmu-miR-29b-3p(1), mmu-miR-29a-3p(1), mmu-miR-29c-3p(1), mmu-miR-33-5p(1), mmu-miR-298-5p(1)

siRNAs for circular RNA silencing
Junction sequence

TGTGAACATTCAGGATTCTGAGAAAC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANKRD44_795_ORF_1

1.2433

0.339145657

0.999892154

1485

ORF sequence:

ATGTGGCTGACCCCACTGCACCGGGCTGTTGCTTCCAGAAGTGAAGAGGCAGTGCAAGTATTGATTAAACACTCGGCTGATGTCAATGCAAGGGACAAGAATTGGCAGACCCCCCTCCATGTGGCAGCAGCCAATAAGGCCGTCAAGTGTGCAGAAGTGATCATTCCACTACTGAGCAGTGTCAATGTCTCCGACAGAGGCGGGCGCACAGCCTTGCACCACGCCGCTCTGAATGGACACATGGAGATGGTCAATTTACTCTTGGCCAAAGGGGCAAACATCAATGCATTTGACAAGAAGGACCGACGAGCTCTCCACTGGGCAGCATACATGGGTCACCTGGACGTTGTGGCGCTGCTCATTAACCATGGTGCAGAAGTTACCTGCAAGGATAAGAAGGGCTACACCCCGCTGCACGCTGCAGCCTCCAATGGGCAGATCAGTGTTGTCAAACATCTCCTGAACCTGGGGGTGGAGATTGATGAAATCAATGTCTATGGAAACACAGCACTTCACATTGCCTGCTACAATGGCCAGGATGCTGTCGTTAATGAGCTGATCGACTATGGTGCTAACGTGAATCAGCCCAACAACAGTGGCTTTACCCCTCTGCACTTTGCAGCGGCGTCTACTCACGGTGCTCTGTGTCTGGAGTTGTTAGTGAACAATGGGGCCGATGTGAACATTCAGGATTCTGAGAAACGAACCCCGCTTCATGTGGCTGCATTCCTGGGAGATGCAGAGATCATTGAACTCCTGATTTTGTCAGGAGCTCGTGTAAATGCCAAGGACAACATGTGGCTGACCCCACTGCACCGGGCTGTTGCTTCCAGAAGTGAAGAGGCAGTGCAAGTATTGATTAAACACTCGGCTGATGTCAATGCAAGGGACAAGAATTGGCAGACCCCCCTCCATGTGGCAGCAGCCAATAAGGCCGTCAAGTGTGCAGAAGTGATCATTCCACTACTGAGCAGTGTCAATGTCTCCGACAGAGGCGGGCGCACAGCCTTGCACCACGCCGCTCTGAATGGACACATGGAGATGGTCAATTTACTCTTGGCCAAAGGGGCAAACATCAATGCATTTGACAAGAAGGACCGACGAGCTCTCCACTGGGCAGCATACATGGGTCACCTGGACGTTGTGGCGCTGCTCATTAACCATGGTGCAGAAGTTACCTGCAAGGATAAGAAGGGCTACACCCCGCTGCACGCTGCAGCCTCCAATGGGCAGATCAGTGTTGTCAAACATCTCCTGAACCTGGGGGTGGAGATTGATGAAATCAATGTCTATGGAAACACAGCACTTCACATTGCCTGCTACAATGGCCAGGATGCTGTCGTTAATGAGCTGATCGACTATGGTGCTAACGTGAATCAGCCCAACAACAGTGGCTTTACCCCTCTGCACTTTGCAGCGGCGTCTACTCACGGTGCTCTGTGTCTGGAGTTGTTAGTGAACAATGGGGCCGATGTGAACATTCAG

Peptide sequence:

MWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQ

IRESfinder result

IRESfinder score

0.426954877

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page