top of page

mmu_circAnkrd13d_334

Basic information of circular RNA
PanCircBase ID:

mmu_circAnkrd13d_334

mm39_Chr. Position ID:

chr19|4330564|4331108|-

Gene name:

Ankrd13d

Transcript:

ENSMUST00000056888.13

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

6,5

Exon/intron offsets:

0,400

Genomic length:

544

Exon/intron sizes in nt:

1,90,144

Flanking exon/introns:

chr19:4323630-4330564|chr19:4331108-4331190

Splice length:

334

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

TACCTCTTGTGTCCAAGATGTGCCCGAGCGATGTGTACCGTGTGTGGAAGCGGGGTGAGAGTCTGCGGGTGGACACTAGTCTCTTGGGCTTTGAGCACATGACCTGGCAGCGTGGCCGAAGGAGCTTCATCTTCAGGGGTCAGGAGGCGGGAGCCTTGGTGATGGAAGTGGATCATGACCGGCAGGTGGTGCACACAGAGACCCTAGCTCCAGCTCTGCATGAACCAGAAGCGCTGCTGGCTGCCATGCGGCCTAGTGAGGAGCACGTGGCCAGTCGGCTCACCTCTCCTATTGTCTCCACCCACCTGGACACTCGCAATGTAGCCTTTGAGAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CAGTCGGCTCACCTCTCCTA

60.39

TGTGCTCAAAGCCCAAGAGA

59.53

162

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ATTGTCTCCACCCACCTGGA

60.48

TGTGCTCAAAGCCCAAGAGA

59.53

143

PCR template sequence:

TGCTGGCTGCCATGCGGCCTAGTGAGGAGCACGTGGCCAGTCGGCTCACCTCTCCTATTGTCTCCACCCACCTGGACACTCGCAATGTAGCCTTTGAGAGTACCTCTTGTGTCCAAGATGTGCCCGAGCGATGTGTACCGTGTGTGGAAGCGGGGTGAGAGTCTGCGGGTGGACACTAGTCTCTTGGGCTTTGAGCACAT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-221-3p(1), mmu-miR-127-5p(1)

siRNAs for circular RNA silencing
Junction sequence

TAGCCTTTGAGAGTACCTCTTGTGTC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANKRD13D_334_ORF_1

1.0534

0.35417195

0.701486866

375

ORF sequence:

ATGTGCCCGAGCGATGTGTACCGTGTGTGGAAGCGGGGTGAGAGTCTGCGGGTGGACACTAGTCTCTTGGGCTTTGAGCACATGACCTGGCAGCGTGGCCGAAGGAGCTTCATCTTCAGGGGTCAGGAGGCGGGAGCCTTGGTGATGGAAGTGGATCATGACCGGCAGGTGGTGCACACAGAGACCCTAGCTCCAGCTCTGCATGAACCAGAAGCGCTGCTGGCTGCCATGCGGCCTAGTGAGGAGCACGTGGCCAGTCGGCTCACCTCTCCTATTGTCTCCACCCACCTGGACACTCGCAATGTAGCCTTTGAGAGTACCTCTTGTGTCCAAGATGTGCCCGAGCGATGTGTACCGTGTGTGGAAGCGGGGTGA

Peptide sequence:

MCPSDVYRVWKRGESLRVDTSLLGFEHMTWQRGRRSFIFRGQEAGALVMEVDHDRQVVHTETLAPALHEPEALLAAMRPSEEHVASRLTSPIVSTHLDTRNVAFESTSCVQDVPERCVPCVEAG

IRESfinder result

IRESfinder score

0.321806727

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page