top of page

mmu_circAnkib1_1000

Basic information of circular RNA
PanCircBase ID:

mmu_circAnkib1_1000

mm39_Chr. Position ID:

chr5|3772545|3805776|-

Gene name:

Ankib1

Transcript:

ENSMUST00000043551.11

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

7

Exon/intron indexes:

10,9,8,7,6,5,4

Exon/intron offsets:

0,4943,7089,9994,11430,24475,33048

Genomic length:

33231

Exon/intron sizes in nt:

89,167,145,89,209,118,183

Flanking exon/introns:

chr5:3763238-3772545|chr5:3805776-3819428

Splice length:

1000

Other database IDs:

circBase: mmu_circ_0012612, CIRCpedia: MMU_CIRCpedia_18491, circAtlas: mmu-Ankib1_0012

circBase: hsa_circ_0135066, circAtlas: hsa-ANKIB1_0021, CIRCpedia: HSA_CIRCpedia_132801

Human Ortholog IDs:
Mature spliced Sequence:

CTCTTAGTAAAACATGGAGGAGACTTGTTTGCTGAAAATGAAAATAGAGATACTCCTTGTGATTGTGCCGAAAAGCAGCAGCACAAAGACCTGGCCCTCAGTCTGGAGTCTCAGATGGTGTTCTCTCGGGACCCGGAGGCCGAAGAAATAGAAGCGGAGTATGCTGCCTTAGACAAGCGAGAGCCATATGAAGGACTAAGGCCCCAGGATCTTCGTAGGTTAAAAGATATGCTTATTGTGGAGACTGCAGACATGCTCCAGGCCCCTCTGTTTACTGCTGAAGCACTGCTTCGAGCTCACGATTGGGACAGGGAGAAGTTGCTTGAAGCTTGGATGTCCAACCCAGAGAACTGCTGCCAGCGGTCAGGGGTGCAGATGCCAACCCCACCACCCAGTGGGTACAATGCCTGGGACACGCTGCCTTCCCCGAGAACTCCAAGGACTACAAGATCCTCTGTCACCTCCCCAGATGAAATCAGTCTGTCTCCTGGGGATTTAGATACCAGTTTGTGTGACATTTGTATGTGCAGTATTTCTGTGTTTGAAGATCCAGTGGATATGCCCTGTGGACATGATTTTTGTAGAGGCTGTTGGGAGGCGTTTTTAAATCTGAAAATTCAAGAAGGTGAAGCCCATAACATTTTCTGCCCTGCATATGAATGCTTTCAACTCGTGCCTGTAGATGTCATAGAAAGTGTAGTTTCTAAGGAGATGGACAAACGATACCTACAGTTTGATATTAAGGCCTTTGTTGAAAATAATCCTGCCATTAAATGGTGTCCTACCGCAGGCTGTGAACGAGCAGTCAGACTGACAAAGCAGGGGTCAAATCCATCTGGGTCTGACACACTCAGCTTCCCATTGCTAAGAGCCCCTGCTGTGGACTGCGGCAAAGGACACCTCTTCTGCTGGGAGTGCCTTGGTGAAGCACATGAGCCTTGTGACTGCCAAACATGGAAAAACTGGTTACAAAAGATAACCGAAATGAAGCCAGAAGAAC

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GTGCCTTGGTGAAGCACATG

60.04

GCTGCTTTTCGGCACAATCA

60.04

165

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGAGCCTTGTGACTGCCAAA

60.11

GCTGCTTTTCGGCACAATCA

60.04

147

PCR template sequence:

CTCTTCTGCTGGGAGTGCCTTGGTGAAGCACATGAGCCTTGTGACTGCCAAACATGGAAAAACTGGTTACAAAAGATAACCGAAATGAAGCCAGAAGAACCTCTTAGTAAAACATGGAGGAGACTTGTTTGCTGAAAATGAAAATAGAGATACTCCTTGTGATTGTGCCGAAAAGCAGCAGCACAAAGACCTGGCCCTCA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

18

Interacting miRNAs (#binding sites)

mmu-miR-29b-1-5p(2), mmu-miR-680(2), mmu-miR-429-3p(1), mmu-miR-200b-3p(1), mmu-miR-150-5p(1), mmu-miR-30e-5p(1), mmu-miR-200c-3p(1), mmu-miR-29b-3p(1), mmu-miR-29a-3p(1), mmu-miR-30a-5p(1), mmu-miR-298-5p(1), mmu-miR-339-5p(1), mmu-miR-30d-5p(1), mmu-miR-218-5p(1), mmu-miR-377-3p(1), mmu-miR-207(1), mmu-miR-3065-5p(1), mmu-miR-542-5p(1)

siRNAs for circular RNA silencing
Junction sequence

AAGCCAGAAGAACCTCTTAGTAAAAC

siRNA sets

TTACTAAGAGGTTCTTCTG, TTTACTAAGAGGTTCTTCT, TACTAAGAGGTTCTTCTGG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANKIB1_1000_ORF_1

0.7538

0.070305237

0.954592841

921

ORF sequence:

ATGGTGTTCTCTCGGGACCCGGAGGCCGAAGAAATAGAAGCGGAGTATGCTGCCTTAGACAAGCGAGAGCCATATGAAGGACTAAGGCCCCAGGATCTTCGTAGGTTAAAAGATATGCTTATTGTGGAGACTGCAGACATGCTCCAGGCCCCTCTGTTTACTGCTGAAGCACTGCTTCGAGCTCACGATTGGGACAGGGAGAAGTTGCTTGAAGCTTGGATGTCCAACCCAGAGAACTGCTGCCAGCGGTCAGGGGTGCAGATGCCAACCCCACCACCCAGTGGGTACAATGCCTGGGACACGCTGCCTTCCCCGAGAACTCCAAGGACTACAAGATCCTCTGTCACCTCCCCAGATGAAATCAGTCTGTCTCCTGGGGATTTAGATACCAGTTTGTGTGACATTTGTATGTGCAGTATTTCTGTGTTTGAAGATCCAGTGGATATGCCCTGTGGACATGATTTTTGTAGAGGCTGTTGGGAGGCGTTTTTAAATCTGAAAATTCAAGAAGGTGAAGCCCATAACATTTTCTGCCCTGCATATGAATGCTTTCAACTCGTGCCTGTAGATGTCATAGAAAGTGTAGTTTCTAAGGAGATGGACAAACGATACCTACAGTTTGATATTAAGGCCTTTGTTGAAAATAATCCTGCCATTAAATGGTGTCCTACCGCAGGCTGTGAACGAGCAGTCAGACTGACAAAGCAGGGGTCAAATCCATCTGGGTCTGACACACTCAGCTTCCCATTGCTAAGAGCCCCTGCTGTGGACTGCGGCAAAGGACACCTCTTCTGCTGGGAGTGCCTTGGTGAAGCACATGAGCCTTGTGACTGCCAAACATGGAAAAACTGGTTACAAAAGATAACCGAAATGAAGCCAGAAGAACCTCTTAGTAAAACATGGAGGAGACTTGTTTGCTGA

Peptide sequence:

MVFSRDPEAEEIEAEYAALDKREPYEGLRPQDLRRLKDMLIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENCCQRSGVQMPTPPPSGYNAWDTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICMCSISVFEDPVDMPCGHDFCRGCWEAFLNLKIQEGEAHNIFCPAYECFQLVPVDVIESVVSKEMDKRYLQFDIKAFVENNPAIKWCPTAGCERAVRLTKQGSNPSGSDTLSFPLLRAPAVDCGKGHLFCWECLGEAHEPCDCQTWKNWLQKITEMKPEEPLSKTWRRLVC

IRESfinder result

IRESfinder score

0.54685852

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page