top of page

mmu_circAnk_420

Basic information of circular RNA
PanCircBase ID:

mmu_circAnk_420

mm39_Chr. Position ID:

chr15|27544336|27557333|+

Gene name:

Ank

Transcript:

ENSMUST00000022875.7

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

2,3,4

Exon/intron offsets:

0,9438,12913

Genomic length:

12997

Exon/intron sizes in nt:

217,119,84

Flanking exon/introns:

chr15:27467185-27544336|chr15:27557333-27562809

Splice length:

420

Other database IDs:

circAtlas: mmu-Ank_0002

circAtlas: hsa-ANKH_0002

Human Ortholog IDs:
Mature spliced Sequence:

GCCTTGAACCGGGGCATCGCTGCAGTCAAGGAGGATGCAGTAGAAATGCTGGCCAGCTACGGGCTGGCGTATTCTTTGATGAAGTTCTTCACGGGGCCCATGAGTGACTTCAAAAATGTGGGCCTGGTGTTCGTGAACAGCAAGAGAGACAGGGCCAAAGCCGTCCTCTGCATGGTGGTGGCCGGTGCCATCGCTGCCGTCTTCCACACCCTGATAGCCTACAGTGACTTAGGGTACTACATCATCAACAAGCTGCATCATGTGGATGAGTCTGTGGGGAGCAAAACACGAAGGGCCTTCCTGTATCTCGCTGCCTTCCCTTTTATGGATGCCATGGCGTGGACTCATGCTGGCATTCTCTTAAAACACAAATACAGTTTCCTGGTGGGATGTGCCTCAATCTCAGATGTCATAGCTCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGGACTCATGCTGGCATTCT

59.38

AAGAATACGCCAGCCCGTAG

59.9

157

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GTGGACTCATGCTGGCATTC

59.26

AAGAATACGCCAGCCCGTAG

59.9

158

PCR template sequence:

TTTTATGGATGCCATGGCGTGGACTCATGCTGGCATTCTCTTAAAACACAAATACAGTTTCCTGGTGGGATGTGCCTCAATCTCAGATGTCATAGCTCAGGCCTTGAACCGGGGCATCGCTGCAGTCAAGGAGGATGCAGTAGAAATGCTGGCCAGCTACGGGCTGGCGTATTCTTTGATGAAGTTCTTCACGGGGCCCA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

10

Interacting miRNAs (#binding sites)

mmu-miR-224-5p(2), mmu-miR-328-3p(1), mmu-miR-298-5p(1), mmu-miR-217-5p(1), mmu-miR-7a-5p(1), mmu-miR-324-5p(1), mmu-miR-339-5p(1), mmu-miR-125a-5p(1), mmu-miR-183-5p(1), mmu-miR-338-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TGTCATAGCTCAGGCCTTGAACCGGG

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANK_420_ORF_1

1.305

0.361473338

0.987617229

795

ORF sequence:

ATGCTGGCCAGCTACGGGCTGGCGTATTCTTTGATGAAGTTCTTCACGGGGCCCATGAGTGACTTCAAAAATGTGGGCCTGGTGTTCGTGAACAGCAAGAGAGACAGGGCCAAAGCCGTCCTCTGCATGGTGGTGGCCGGTGCCATCGCTGCCGTCTTCCACACCCTGATAGCCTACAGTGACTTAGGGTACTACATCATCAACAAGCTGCATCATGTGGATGAGTCTGTGGGGAGCAAAACACGAAGGGCCTTCCTGTATCTCGCTGCCTTCCCTTTTATGGATGCCATGGCGTGGACTCATGCTGGCATTCTCTTAAAACACAAATACAGTTTCCTGGTGGGATGTGCCTCAATCTCAGATGTCATAGCTCAGGCCTTGAACCGGGGCATCGCTGCAGTCAAGGAGGATGCAGTAGAAATGCTGGCCAGCTACGGGCTGGCGTATTCTTTGATGAAGTTCTTCACGGGGCCCATGAGTGACTTCAAAAATGTGGGCCTGGTGTTCGTGAACAGCAAGAGAGACAGGGCCAAAGCCGTCCTCTGCATGGTGGTGGCCGGTGCCATCGCTGCCGTCTTCCACACCCTGATAGCCTACAGTGACTTAGGGTACTACATCATCAACAAGCTGCATCATGTGGATGAGTCTGTGGGGAGCAAAACACGAAGGGCCTTCCTGTATCTCGCTGCCTTCCCTTTTATGGATGCCATGGCGTGGACTCATGCTGGCATTCTCTTAAAACACAAATACAGTTTCCTGGTGGGATGTGCCTCAATCTCAGATGTCATAGCTCAG

Peptide sequence:

MLASYGLAYSLMKFFTGPMSDFKNVGLVFVNSKRDRAKAVLCMVVAGAIAAVFHTLIAYSDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHKYSFLVGCASISDVIAQALNRGIAAVKEDAVEMLASYGLAYSLMKFFTGPMSDFKNVGLVFVNSKRDRAKAVLCMVVAGAIAAVFHTLIAYSDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHKYSFLVGCASISDVIAQ

IRESfinder result

IRESfinder score

0.362360859

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page