top of page

mmu_circAnk2_693_2

Basic information of circular RNA
PanCircBase ID:

mmu_circAnk2_693_2

mm39_Chr. Position ID:

chr3|126822867|126841929|-

Gene name:

Ank2

Transcript:

ENSMUST00000182078.9

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

14,13,12,11,10,9

Exon/intron offsets:

0,256,2897,9528,17506,18963

Genomic length:

19062

Exon/intron sizes in nt:

99,99,198,99,99,99

Flanking exon/introns:

chr3:126817039-126822867|chr3:126841929-126845874

Splice length:

693

Other database IDs:

circAtlas: hsa-ANK2_0013

Human Ortholog IDs:
Mature spliced Sequence:

AGTGGCTTCACTCCTTTGCACATAGCTGCACACTATGGGAATGTAAATGTGGCAACTCTTCTTCTAAACCGGGGAGCTGCTGTGGACTTCACCGCCAGGAATGGAATCACTCCTCTGCACGTGGCTTCCAAACGAGGAAATACCAACATGGTGAAGCTTCTACTGGATCGAGGTGGTCAGATTGATGCCAAAACTAGGGACGGGCTGACACCACTTCACTGTGCTGCGCGGAGTGGGCATGATCAAGTGGTGGAGCTGCTGTTGGAACGGAAGGCTCCCTTGCTGGCGAGGACCAAGAATGGGCTGTCCCCGCTTCACATGGCTGCGCAGGGGGACCACGTGGAATGTGTGAAGCACCTGCTCCAATACAAGGCGCCTGTCGATGACGTCACCCTGGATTACCTGACGGCTCTTCATGTTGCTGCACACTGTGGGCACTACCGTGTAACCAAACTCCTGCTGGACAAGAGAGCCAACCCGAACGCAAGAGCCCTGAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCAATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAACGGAGCCTCTCCAGATGTCACTAACATT

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TTGTCCTCCTTCTGCTGCAG

59.96

GTGAAGTCCACAGCAGCTCC

60.95

142

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ACCAATACATGTGGCTGCCT

59.67

GCAGCTCCCCGGTTTAGAAG

60.74

168

PCR template sequence:

GTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAACGGAGCCTCTCCAGATGTCACTAACATTAGTGGCTTCACTCCTTTGCACATAGCTGCACACTATGGGAATGTAAATGTGGCAACTCTTCTTCTAAACCGGGGAGCTGCTGTGGACTTCACCGCCAGGA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-298-5p(1), mmu-miR-128-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TGTCACTAACATTAGTGGCTTCACTC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANK2_693_2_ORF_1

1.176

0.314968201

0.999208066

1239

ORF sequence:

ATGGTGAAGCTTCTACTGGATCGAGGTGGTCAGATTGATGCCAAAACTAGGGACGGGCTGACACCACTTCACTGTGCTGCGCGGAGTGGGCATGATCAAGTGGTGGAGCTGCTGTTGGAACGGAAGGCTCCCTTGCTGGCGAGGACCAAGAATGGGCTGTCCCCGCTTCACATGGCTGCGCAGGGGGACCACGTGGAATGTGTGAAGCACCTGCTCCAATACAAGGCGCCTGTCGATGACGTCACCCTGGATTACCTGACGGCTCTTCATGTTGCTGCACACTGTGGGCACTACCGTGTAACCAAACTCCTGCTGGACAAGAGAGCCAACCCGAACGCAAGAGCCCTGAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCAATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAACGGAGCCTCTCCAGATGTCACTAACATTAGTGGCTTCACTCCTTTGCACATAGCTGCACACTATGGGAATGTAAATGTGGCAACTCTTCTTCTAAACCGGGGAGCTGCTGTGGACTTCACCGCCAGGAATGGAATCACTCCTCTGCACGTGGCTTCCAAACGAGGAAATACCAACATGGTGAAGCTTCTACTGGATCGAGGTGGTCAGATTGATGCCAAAACTAGGGACGGGCTGACACCACTTCACTGTGCTGCGCGGAGTGGGCATGATCAAGTGGTGGAGCTGCTGTTGGAACGGAAGGCTCCCTTGCTGGCGAGGACCAAGAATGGGCTGTCCCCGCTTCACATGGCTGCGCAGGGGGACCACGTGGAATGTGTGAAGCACCTGCTCCAATACAAGGCGCCTGTCGATGACGTCACCCTGGATTACCTGACGGCTCTTCATGTTGCTGCACACTGTGGGCACTACCGTGTAACCAAACTCCTGCTGGACAAGAGAGCCAACCCGAACGCAAGAGCCCTGAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCAATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAACGGAGCCTCTCCAGATGTCACTAACATT

Peptide sequence:

MVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNISGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNI

IRESfinder result

IRESfinder score

0.378874814

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page