top of page

mmu_circAnapc5_544

Basic information of circular RNA
PanCircBase ID:

mmu_circAnapc5_544

mm39_Chr. Position ID:

chr5|122944307|122956067|-

Gene name:

Anapc5

Transcript:

ENSMUST00000086216.9

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

4

Exon/intron indexes:

7,6,5,4

Exon/intron offsets:

0,1055,8304,11576

Genomic length:

11760

Exon/intron sizes in nt:

191,102,67,184

Flanking exon/introns:

chr5:122940967-122944307|chr5:122956067-122956916

Splice length:

544

Other database IDs:

circAtlas: mmu-Anapc5_0001

circBase: hsa_circ_0097553, circAtlas: hsa-APC5_0001, CIRCpedia: HSA_CIRCpedia_66707

Human Ortholog IDs:
Mature spliced Sequence:

GTCTGTTCCTGCGCCACATGATCTTGGCCTACAGTAAGCTTTCTTTCAGTCAAGTGTTTAAGCTGTACACTGCCCTCCAGCAGTACTTCCAGAACGGGGAGAAAAAGACGGTGGAAGATGCTGATATGGACCGAGAGGATGGAGAGAAACAGATGGAGAAGGAAGAGCTCGACGTGTCCGTGAGAGAAGAGGAAGTATCTTGCAGTGGTCCTCTGTCCCAAAAACAAGCGGAATTTTTTCTCTCTCAGCAGGCCGCTTTGTTGAAGAATGATGAGACTAAAGCCCTCACCCCAGCTTCCTTGCAGAAGGAATTGAACAACCTGTTGAAATTTAATCCTGATTTTGCTGAAGCTCATTACCTCAGCTACTTAAACAACCTCCGTGTTCAAGATGTTTTCAGCTCAACACACAGCCTCCTGCATTATTTTGACCGCCTGATTCTCACTGGAGCGGAGGGCAAAAGTAATGGGGAAGAGGGTTATGGCCGGAGCCTGAGATACGCTGCTCTCAACCTGGCTGCCCTGCACTGCCGCTTCGGTCACTA

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GAAGAGGGTTATGGCCGGAG

59.89

CCCCGTTCTGGAAGTACTGC

60.39

173

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ATACGCTGCTCTCAACCTGG

59.82

CCCCGTTCTGGAAGTACTGC

60.39

147

PCR template sequence:

CTGGAGCGGAGGGCAAAAGTAATGGGGAAGAGGGTTATGGCCGGAGCCTGAGATACGCTGCTCTCAACCTGGCTGCCCTGCACTGCCGCTTCGGTCACTAGTCTGTTCCTGCGCCACATGATCTTGGCCTACAGTAAGCTTTCTTTCAGTCAAGTGTTTAAGCTGTACACTGCCCTCCAGCAGTACTTCCAGAACGGGGA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

8

Interacting miRNAs (#binding sites)

mmu-miR-34c-5p(1), mmu-miR-30e-5p(1), mmu-miR-34a-5p(1), mmu-miR-152-3p(1), mmu-miR-136-5p(1), mmu-miR-370-3p(1), mmu-miR-34b-5p(1), mmu-miR-207(1)

siRNAs for circular RNA silencing
Junction sequence

GCTTCGGTCACTAGTCTGTTCCTGCG

siRNA sets

ACAGACTAGTGACCGAAGC, AACAGACTAGTGACCGAAG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANAPC5_544_ORF_1

1.1604

0.300598577

0.873097691

528

ORF sequence:

ATGATCTTGGCCTACAGTAAGCTTTCTTTCAGTCAAGTGTTTAAGCTGTACACTGCCCTCCAGCAGTACTTCCAGAACGGGGAGAAAAAGACGGTGGAAGATGCTGATATGGACCGAGAGGATGGAGAGAAACAGATGGAGAAGGAAGAGCTCGACGTGTCCGTGAGAGAAGAGGAAGTATCTTGCAGTGGTCCTCTGTCCCAAAAACAAGCGGAATTTTTTCTCTCTCAGCAGGCCGCTTTGTTGAAGAATGATGAGACTAAAGCCCTCACCCCAGCTTCCTTGCAGAAGGAATTGAACAACCTGTTGAAATTTAATCCTGATTTTGCTGAAGCTCATTACCTCAGCTACTTAAACAACCTCCGTGTTCAAGATGTTTTCAGCTCAACACACAGCCTCCTGCATTATTTTGACCGCCTGATTCTCACTGGAGCGGAGGGCAAAAGTAATGGGGAAGAGGGTTATGGCCGGAGCCTGAGATACGCTGCTCTCAACCTGGCTGCCCTGCACTGCCGCTTCGGTCACTAG

Peptide sequence:

MILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMDREDGEKQMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQAALLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAEGKSNGEEGYGRSLRYAALNLAALHCRFGH

IRESfinder result

IRESfinder score

0.665072714

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page