top of page

mmu_circAnapc1_390

Basic information of circular RNA
PanCircBase ID:

mmu_circAnapc1_390

mm39_Chr. Position ID:

chr2|128505794|128508625|-

Gene name:

Anapc1

Transcript:

ENSMUST00000014499.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

17,16,15

Exon/intron offsets:

0,1573,2690

Genomic length:

2831

Exon/intron sizes in nt:

1,88,61,141

Flanking exon/introns:

chr2:128502799-128505794|chr2:128508625-128510844

Splice length:

390

Other database IDs:

CIRCpedia: MMU_CIRCpedia_7239, circAtlas: mmu-Apc1_0047

Human Ortholog IDs:
Mature spliced Sequence:

GTGGTTCTGTTGTCTCCAGTTCCAGAATTGAGGGATTCTTCAAAACTTAATGATTCTCTCTACAATGAGGATTGCACATTCCAGCAGCTTGGAACTTACATTCATTCTGTGCGAGACCCTGTTCATAACAGAGTCACTCTAGAACTGAGCAATGGCTCCATGGTTCGGATCACTATCCCTGAAGTGGCCACCTCGGAATTAGTACAAACGTGTCTGCAAGCAATTAAGTTCATCCTGCCAAAAGAAGTAGCCATTCAGGTGCTCGTCAAGTGGTACAATGTGCACAGTGCTCCAGGAGGACCCAGCTGTCACTCAGAGTGGAGTTTATTTGTGATTTGTCTCTTGAACATGATGGGTTATAACACAGACCGCTTAGCATGGACCCGAAGT

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CCAGCTGTCACTCAGAGTGG

60.04

GCTGCTGGAATGTGCAATCC

60.18

177

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CCAGCTGTCACTCAGAGTGG

60.04

CAAGCTGCTGGAATGTGCAA

59.68

180

PCR template sequence:

TCCAGGAGGACCCAGCTGTCACTCAGAGTGGAGTTTATTTGTGATTTGTCTCTTGAACATGATGGGTTATAACACAGACCGCTTAGCATGGACCCGAAGTGTGGTTCTGTTGTCTCCAGTTCCAGAATTGAGGGATTCTTCAAAACTTAATGATTCTCTCTACAATGAGGATTGCACATTCCAGCAGCTTGGAACTTACA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

NA

Interacting miRNAs (#binding sites)

NA

siRNAs for circular RNA silencing
Junction sequence

ATGGACCCGAAGTGTGGTTCTGTTGT

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANAPC1_390_ORF_1

0.7678

0.150943689

0.779876736

621

ORF sequence:

ATGGTTCGGATCACTATCCCTGAAGTGGCCACCTCGGAATTAGTACAAACGTGTCTGCAAGCAATTAAGTTCATCCTGCCAAAAGAAGTAGCCATTCAGGTGCTCGTCAAGTGGTACAATGTGCACAGTGCTCCAGGAGGACCCAGCTGTCACTCAGAGTGGAGTTTATTTGTGATTTGTCTCTTGAACATGATGGGTTATAACACAGACCGCTTAGCATGGACCCGAAGTGTGGTTCTGTTGTCTCCAGTTCCAGAATTGAGGGATTCTTCAAAACTTAATGATTCTCTCTACAATGAGGATTGCACATTCCAGCAGCTTGGAACTTACATTCATTCTGTGCGAGACCCTGTTCATAACAGAGTCACTCTAGAACTGAGCAATGGCTCCATGGTTCGGATCACTATCCCTGAAGTGGCCACCTCGGAATTAGTACAAACGTGTCTGCAAGCAATTAAGTTCATCCTGCCAAAAGAAGTAGCCATTCAGGTGCTCGTCAAGTGGTACAATGTGCACAGTGCTCCAGGAGGACCCAGCTGTCACTCAGAGTGGAGTTTATTTGTGATTTGTCTCTTGAACATGATGGGTTATAACACAGACCGCTTAGCATGGACCCGAAGT

Peptide sequence:

MVRITIPEVATSELVQTCLQAIKFILPKEVAIQVLVKWYNVHSAPGGPSCHSEWSLFVICLLNMMGYNTDRLAWTRSVVLLSPVPELRDSSKLNDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELSNGSMVRITIPEVATSELVQTCLQAIKFILPKEVAIQVLVKWYNVHSAPGGPSCHSEWSLFVICLLNMMGYNTDRLAWTRS

IRESfinder result

IRESfinder score

0.762551394

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page