top of page

mmu_circAnapc1_367

Basic information of circular RNA
PanCircBase ID:

mmu_circAnapc1_367

mm39_Chr. Position ID:

chr2|128517590|128518167|-

Gene name:

Anapc1

Transcript:

ENSMUST00000014499.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

9,8

Exon/intron offsets:

0,431

Genomic length:

577

Exon/intron sizes in nt:

221,146

Flanking exon/introns:

chr2:128516680-128517590|chr2:128518167-128520130

Splice length:

367

Other database IDs:

circBase: mmu_circ_0009324, CIRCpedia: MMU_CIRCpedia_7249, circAtlas: mmu-Anapc1_0038

CIRCpedia: HSA_CIRCpedia_134614

Human Ortholog IDs:
Mature spliced Sequence:

GTCTTTTTGGCTCATCACGGGTACAGTATGTTGTAGATCCAGCAGTGAAAATTGTGTTTCTGAACATTGACCCCTCCATTGTCATGACCTATGATGCTGTTCAGAATGTGCATTCTGTGTGGACTCTGCGGAGGGTAAAGCCAGAGGAAGAGAATGCTGTTTTAAAGTTCCCTGAGCAGGCAGGGACCCTGCAGAATGCAACTACTAGCAGCTCCCTGACAGCACATCTCAGAAGCCTCTCCAAAGGCGAATCCCCTGTGGCTTCGCCGTTCCAGAATTACTCTTCCATTCACAGCCAGAGTCGCTCAACCTCTTCGCCCAGTCTACACTCTCGGTCGCCTTCCATTTCCAACATGGCGGCTCTAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

ATTCACAGCCAGAGTCGCTC

60.11

GGTCATGACAATGGAGGGGT

59.37

169

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CCTCTTCGCCCAGTCTACAC

59.83

GGTCATGACAATGGAGGGGT

59.37

147

PCR template sequence:

CGTTCCAGAATTACTCTTCCATTCACAGCCAGAGTCGCTCAACCTCTTCGCCCAGTCTACACTCTCGGTCGCCTTCCATTTCCAACATGGCGGCTCTAAGGTCTTTTTGGCTCATCACGGGTACAGTATGTTGTAGATCCAGCAGTGAAAATTGTGTTTCTGAACATTGACCCCTCCATTGTCATGACCTATGATGCTGT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

NA

Interacting miRNAs (#binding sites)

NA

siRNAs for circular RNA silencing
Junction sequence

TGGCGGCTCTAAGGTCTTTTTGGCTC

siRNA sets

AAAAGACCTTAGAGCCGCC, AAAAAGACCTTAGAGCCGC, CAAAAAGACCTTAGAGCCG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCANAPC1_367_ORF_1

0.9167

0.041839895

0.303667281

354

ORF sequence:

ATGACCTATGATGCTGTTCAGAATGTGCATTCTGTGTGGACTCTGCGGAGGGTAAAGCCAGAGGAAGAGAATGCTGTTTTAAAGTTCCCTGAGCAGGCAGGGACCCTGCAGAATGCAACTACTAGCAGCTCCCTGACAGCACATCTCAGAAGCCTCTCCAAAGGCGAATCCCCTGTGGCTTCGCCGTTCCAGAATTACTCTTCCATTCACAGCCAGAGTCGCTCAACCTCTTCGCCCAGTCTACACTCTCGGTCGCCTTCCATTTCCAACATGGCGGCTCTAAGGTCTTTTTGGCTCATCACGGGTACAGTATGTTGTAGATCCAGCAGTGAAAATTGTGTTTCTGAACATTGA

Peptide sequence:

MTYDAVQNVHSVWTLRRVKPEEENAVLKFPEQAGTLQNATTSSSLTAHLRSLSKGESPVASPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALRSFWLITGTVCCRSSSENCVSEH

IRESfinder result

IRESfinder score

0.624509211

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page