top of page

mmu_circAkt3_658

Basic information of circular RNA
PanCircBase ID:

mmu_circAkt3_658

mm39_Chr. Position ID:

chr1|176859215|176894899|-

Gene name:

Akt3

Transcript:

ENSMUST00000019843.15

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

5

Exon/intron indexes:

12,11,10,9,8

Exon/intron offsets:

0,12125,18388,27684,35561

Genomic length:

35684

Exon/intron sizes in nt:

1,03,88,21,51,29,123

Flanking exon/introns:

chr1:176847711-176859215|chr1:176894899-176906339

Splice length:

658

Other database IDs:

circBase: mmu_circ_0008474, CIRCpedia: MMU_CIRCpedia_12065, circAtlas: mmu-Akt3_0004

circBase: hsa_circ_0002240, circAtlas: hsa-AKT3_0002, CIRCpedia: HSA_CIRCpedia_30932

Human Ortholog IDs:
Mature spliced Sequence:

CTGTTTTTCCATTTGTCGAGAGAGCGAGTGTTCTCTGAGGACCGCACACGTTTCTATGGTGCAGAAATTGTCTCTGCTTTGGACTATCTACATTCTGGAAAGATTGTGTACCGTGATCTCAAGTTGGAGAATTTGATGCTAGATAAGGATGGCCATATAAAAATTACGGATTTTGGGCTTTGCAAAGAAGGGATCACAGATGCAGCTACCATGAAGACATTCTGTGGCACACCAGAGTACCTGGCACCAGAGGTATTAGAAGATAATGACTATGGCCGAGCCGTGGACTGGTGGGGCTTAGGTGTTGTCATGTATGAAATGATGTGTGGAAGGTTGCCTTTCTACAACCAGGATCATGAGAAACTCTTTGAATTAATACTAATGGAAGACATTAAATTCCCCCGAACACTCTCTTCAGATGCAAAATCATTGCTTTCAGGGCTCTTGATAAAGGATCCAAATAAACGCCTTGGTGGAGGGCCAGATGATGCAAAAGAAATCATGAGGCATAGTTTTTTTTCTGGAGTAAACTGGCAAGATGTATATGACAAAAAGCTTGTACCTCCTTTTAAGCCTCAAGTAACATCTGAAACAGACACCCGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAGT

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TAACATCTGAAACAGACACCCGA

59.68

GCACCATAGAAACGTGTGCG

60.18

140

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GTAACATCTGAAACAGACACCCG

59.57

GCACCATAGAAACGTGTGCG

60.18

141

PCR template sequence:

GTACCTCCTTTTAAGCCTCAAGTAACATCTGAAACAGACACCCGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAGTCTGTTTTTCCATTTGTCGAGAGAGCGAGTGTTCTCTGAGGACCGCACACGTTTCTATGGTGCAGAAATTGTCTCTGCTTTGGACTATCTACATTCTGGAA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

NA

Interacting miRNAs (#binding sites)

NA

siRNAs for circular RNA silencing
Junction sequence

CCACCTGAAAAGTCTGTTTTTCCATT

siRNA sets

AAAACAGACTTTTCAGGTG,AAAAACAGACTTTTCAGGT,AATGGAAAAACAGACTTTT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCAKT3_658_ORF_1

0.7962

0.050060858

0.612966935

561

ORF sequence:

ATGCTAGATAAGGATGGCCATATAAAAATTACGGATTTTGGGCTTTGCAAAGAAGGGATCACAGATGCAGCTACCATGAAGACATTCTGTGGCACACCAGAGTACCTGGCACCAGAGGTATTAGAAGATAATGACTATGGCCGAGCCGTGGACTGGTGGGGCTTAGGTGTTGTCATGTATGAAATGATGTGTGGAAGGTTGCCTTTCTACAACCAGGATCATGAGAAACTCTTTGAATTAATACTAATGGAAGACATTAAATTCCCCCGAACACTCTCTTCAGATGCAAAATCATTGCTTTCAGGGCTCTTGATAAAGGATCCAAATAAACGCCTTGGTGGAGGGCCAGATGATGCAAAAGAAATCATGAGGCATAGTTTTTTTTCTGGAGTAAACTGGCAAGATGTATATGACAAAAAGCTTGTACCTCCTTTTAAGCCTCAAGTAACATCTGAAACAGACACCCGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAGTCTGTTTTTCCATTTGTCGAGAGAGCGAGTGTTCTCTGA

Peptide sequence:

MLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKSVFPFVERASVL

IRESfinder result

IRESfinder score

0.547472696

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page