top of page

mmu_circAkap10_232

Basic information of circular RNA
PanCircBase ID:

mmu_circAkap10_232

mm39_Chr. Position ID:

chr11|61768132|61777608|-

Gene name:

Akap10

Transcript:

ENSMUST00000102650.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

14,13,12

Exon/intron offsets:

0,667,9393

Genomic length:

9476

Exon/intron sizes in nt:

96,53,83

Flanking exon/introns:

chr11:61763847-61768132|chr11:61777608-61781063

Splice length:

232

Other database IDs:

circAtlas: hsa-AKAP10_0048, CIRCpedia: HSA_CIRCpedia_77998

Human Ortholog IDs:
Mature spliced Sequence:

GAAGATGTCCTTTGGGAGAGTTAGTGATTTGGGGCAGTTCATCCGAGAGTCTGAGCCTGAACCTGATGTGAAGAAATCAAAAGGATTCATGTTCTCACAAGCTATGAAGAAGTGGGTGCAAGGAAATACTGACGAGGCCCAAGAAGAGCTAGCTTGGAAGATTGCAAAAATGATAGTGAGTGATGTTATGCAGCAGGCACACCATGATCAACCACTAGAGAAGTCTACAAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CGAGGCCCAAGAAGAGCTAG

59.9

TTCAGGCTCAGACTCTCGGA

59.96

161

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GAGGCCCAAGAAGAGCTAGC

60.18

TTCAGGCTCAGACTCTCGGA

59.96

160

PCR template sequence:

CGAGGCCCAAGAAGAGCTAGCTTGGAAGATTGCAAAAATGATAGTGAGTGATGTTATGCAGCAGGCACACCATGATCAACCACTAGAGAAGTCTACAAAGGAAGATGTCCTTTGGGAGAGTTAGTGATTTGGGGCAGTTCATCCGAGAGTCTGAGCCTGAACCTGATGTGAAGAAATCAAAAGGATTCATGTTCTCACAA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-24-3p(1), mmu-miR-129-5p(1), mmu-miR-484(1)

siRNAs for circular RNA silencing
Junction sequence

GAAGTCTACAAAGGAAGATGTCCTTT

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCAKAP10_232_ORF_1

1.0485

0.173389185

0.315031801

252

ORF sequence:

ATGTCCTTTGGGAGAGTTAGTGATTTGGGGCAGTTCATCCGAGAGTCTGAGCCTGAACCTGATGTGAAGAAATCAAAAGGATTCATGTTCTCACAAGCTATGAAGAAGTGGGTGCAAGGAAATACTGACGAGGCCCAAGAAGAGCTAGCTTGGAAGATTGCAAAAATGATAGTGAGTGATGTTATGCAGCAGGCACACCATGATCAACCACTAGAGAAGTCTACAAAGGAAGATGTCCTTTGGGAGAGTTAG

Peptide sequence:

MSFGRVSDLGQFIRESEPEPDVKKSKGFMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAHHDQPLEKSTKEDVLWES

IRESfinder result

IRESfinder score

0.374299295

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page