top of page

mmu_circAhi1_739

Basic information of circular RNA
PanCircBase ID:

mmu_circAhi1_739

mm39_Chr. Position ID:

chr10|20860203|20893932|+

Gene name:

Ahi1

Transcript:

ENSMUST00000105525.12

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

13,14,15,16,17,18

Exon/intron offsets:

0,2665,4239,16201,23447,33608

Genomic length:

33729

Exon/intron sizes in nt:

11,91,31,14,12,00,27,100

Flanking exon/introns:

chr10:20857329-20860203|chr10:20893932-20917084

Splice length:

739

Other database IDs:

CIRCpedia: MMU_CIRCpedia_221731, circAtlas: mmu-Ahi1_0013

circAtlas: hsa-AHI1_0033

Human Ortholog IDs:
Mature spliced Sequence:

GAAATTAAGGAAACTGAATTCAGGGGAGTTCCAATAAGTTACCTGGAGGTTCATCCCAATGGAAAGCGTTTGCTAATCCACACCAAAGACAGTACTCTGAGGATTATGGACCTGCGGATATTGGCAGCCAGGAAATTTGTGGGTGCAGCAAATTACCGTGAGAAGATCCATAGCACCTTGACGCCGTGCGGGACTCTGCTCTTTTCTGGGAGTGAGGATGGGATAGTATACGTTTGGAACCCAGAGACAGGAGAACAAGTGGCAATGTACTCTGACCTGCCATTCAAGTCCACAATCCGAGACATCTCTTACCACCCCCTGGAGAATATGGTTGCCTTCTGTGCCTTTGGACAGAGCGAGCCGATTCTTCTTTATATTTATGATTTCCAGGTAGCCCAGCAGGAGGCTGAAATGTTGAAACGCTATAGTGGGACACTCCCGTTGCCTGGGATACATCAGAGTGAGGATGCTTTATGCACCTGCCCTAAGCTGCCCCAGCAGGGCTCTTTTCAGATTGATGAATTTGTCAACACTGAAAATAGTTCATCAAGAAAGATTCAACTTGTGAAACAGAGACTCGAAACTGTCACAGAGGTGATACGATCCTGTGCTGCAAAAGTCAACAAAAATCTCTCAATGACTTCGCCACCACCAGGCCCTGCAAAGAAGCCCAGGGTAAAGCAGTCGTTCGTGCTGACCACTGATGAGATCATACATCAGTTTGGACTCCCCCAGACTG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CCCAGGGTAAAGCAGTCGTT

59.96

GCAAACGCTTTCCATTGGGA

59.68

143

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CCCAGGGTAAAGCAGTCGTT

59.96

AGCAAACGCTTTCCATTGGG

59.68

144

PCR template sequence:

ACTTCGCCACCACCAGGCCCTGCAAAGAAGCCCAGGGTAAAGCAGTCGTTCGTGCTGACCACTGATGAGATCATACATCAGTTTGGACTCCCCCAGACTGGAAATTAAGGAAACTGAATTCAGGGGAGTTCCAATAAGTTACCTGGAGGTTCATCCCAATGGAAAGCGTTTGCTAATCCACACCAAAGACAGTACTCTGA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

4

Interacting miRNAs (#binding sites)

mmu-miR-370-3p(2), mmu-miR-122-5p(1), mmu-miR-3470b(1), mmu-miR-540-3p(1)

siRNAs for circular RNA silencing
Junction sequence

CTCCCCCAGACTGGAAATTAAGGAAA

siRNA sets

TTTCCTTAATTTCCAGTCT,TTCCTTAATTTCCAGTCTG,CTTAATTTCCAGTCTGGGG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCAHI1_739_ORF_1

0.9613

0.17705265

0.943712197

774

ORF sequence:

ATGAGATCATACATCAGTTTGGACTCCCCCAGACTGGAAATTAAGGAAACTGAATTCAGGGGAGTTCCAATAAGTTACCTGGAGGTTCATCCCAATGGAAAGCGTTTGCTAATCCACACCAAAGACAGTACTCTGAGGATTATGGACCTGCGGATATTGGCAGCCAGGAAATTTGTGGGTGCAGCAAATTACCGTGAGAAGATCCATAGCACCTTGACGCCGTGCGGGACTCTGCTCTTTTCTGGGAGTGAGGATGGGATAGTATACGTTTGGAACCCAGAGACAGGAGAACAAGTGGCAATGTACTCTGACCTGCCATTCAAGTCCACAATCCGAGACATCTCTTACCACCCCCTGGAGAATATGGTTGCCTTCTGTGCCTTTGGACAGAGCGAGCCGATTCTTCTTTATATTTATGATTTCCAGGTAGCCCAGCAGGAGGCTGAAATGTTGAAACGCTATAGTGGGACACTCCCGTTGCCTGGGATACATCAGAGTGAGGATGCTTTATGCACCTGCCCTAAGCTGCCCCAGCAGGGCTCTTTTCAGATTGATGAATTTGTCAACACTGAAAATAGTTCATCAAGAAAGATTCAACTTGTGAAACAGAGACTCGAAACTGTCACAGAGGTGATACGATCCTGTGCTGCAAAAGTCAACAAAAATCTCTCAATGACTTCGCCACCACCAGGCCCTGCAAAGAAGCCCAGGGTAAAGCAGTCGTTCGTGCTGACCACTGATGAGATCATACATCAGTTTGGACTCCCCCAGACT

Peptide sequence:

MRSYISLDSPRLEIKETEFRGVPISYLEVHPNGKRLLIHTKDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYVWNPETGEQVAMYSDLPFKSTIRDISYHPLENMVAFCAFGQSEPILLYIYDFQVAQQEAEMLKRYSGTLPLPGIHQSEDALCTCPKLPQQGSFQIDEFVNTENSSSRKIQLVKQRLETVTEVIRSCAAKVNKNLSMTSPPPGPAKKPRVKQSFVLTTDEIIHQFGLPQT

IRESfinder result

IRESfinder score

0.665788439

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page