top of page

mmu_circAdipor2_861

Basic information of circular RNA
PanCircBase ID:

mmu_circAdipor2_861

mm39_Chr. Position ID:

chr6|119334176|119342341|-

Gene name:

Adipor2

Transcript:

ENSMUST00000032272.13

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

5

Exon/intron indexes:

7,6,5,4,3

Exon/intron offsets:

0,1706,2135,4612,8045

Genomic length:

8165

Exon/intron sizes in nt:

194,188,187,172,120

Flanking exon/introns:

chr6:119332889-119334176|chr6:119342341-119347110

Splice length:

861

Other database IDs:

CIRCpedia: MMU_CIRCpedia_4721, circAtlas: mmu-Adipor2_0007

circBase: hsa_circ_0025005, circAtlas: hsa-ADIPOR2_0006, CIRCpedia: HSA_CIRCpedia_7863

Human Ortholog IDs:
Mature spliced Sequence:

AGCCCGGAGGAGCCCGAGTGTCATGATGACAATTCCCAGGAAGATGAAGGGTTTATGGGCATGTCCCCGCTCCTACAGGCCCATCATGCTATGGAACGAATGGAAGAGTTTGTTTGTAAGGTGTGGGAAGGCCGATGGCGAGTGATCCCTCACGATGTGCTACCGGATTGGCTTAAGGATAATGACTTCCTTCTCCATGGACACCGGCCTCCTATGCCTTCCTTTCGGGCCTGTTTTAAGAGCATTTTTAGAATACACACAGAGACGGGCAACATTTGGACACATCTCCTAGGTTGTGTATTCTTCCTGTGCCTGGGGATCTTTTATATGTTTCGCCCAAATATATCTTTTGTGGCCCCTCTGCAAGAGAAAGTGGTCTTTGGCTTGTTCTTCTTGGGAGCCATTCTCTGCCTTTCCTTTTCATGGCTCTTCCACACGGTGTACTGCCACTCAGAAGGGGTCTCCCGACTCTTCTCTAAATTGGATTACTCTGGTATTGCTCTTCTGATCATGGGAAGTTTTGTTCCTTGGCTTTATTATTCTTTCTACTGTAACCCACAACCTTGCTTCATCTACCTGATTGTCATCTGTGTGCTGGGCATTGCAGCCATTATCGTCTCTCAGTGGGACATGTTTGCCACCCCTCAGTATCGGGGGGTCAGAGCAGGAGTGTTCGTGGGCTTAGGCCTGAGTGGAATCATCCCTACCTTGCATTATGTCATCTCAGAAGGGTTCCTGAAGGCTGCCACCATAGGGCAGATAGGCTGGCTAATGCTTATGGCTAGCCTCTATATCACCGGAGCTGCCCTCTATGCGGCCCGTATCCCTGAGCGCTTCTTTCCTGGCAAATGTGACATCTGG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TATATCACCGGAGCTGCCCT

60.18

CCATAGCATGATGGGCCTGT

59.89

166

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CTATATCACCGGAGCTGCCC

59.75

CCATAGCATGATGGGCCTGT

59.89

167

PCR template sequence:

AGGCTGGCTAATGCTTATGGCTAGCCTCTATATCACCGGAGCTGCCCTCTATGCGGCCCGTATCCCTGAGCGCTTCTTTCCTGGCAAATGTGACATCTGGAGCCCGGAGGAGCCCGAGTGTCATGATGACAATTCCCAGGAAGATGAAGGGTTTATGGGCATGTCCCCGCTCCTACAGGCCCATCATGCTATGGAACGAA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

12

Interacting miRNAs (#binding sites)

mmu-miR-23b-3p(1), mmu-miR-20b-5p(1), mmu-miR-93-5p(1), mmu-miR-20a-5p(1), mmu-miR-205-5p(1), mmu-miR-335-5p(1), mmu-miR-23a-3p(1), mmu-miR-143-3p(1), mmu-miR-30d-5p(1), mmu-miR-433-3p(1), mmu-miR-494-3p(1), mmu-miR-383-5p(1)

siRNAs for circular RNA silencing
Junction sequence

ATGTGACATCTGGAGCCCGGAGGAGC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCADIPOR2_861_ORF_1

0.8369

0.118369422

0.999848347

1668

ORF sequence:

ATGGGCATGTCCCCGCTCCTACAGGCCCATCATGCTATGGAACGAATGGAAGAGTTTGTTTGTAAGGTGTGGGAAGGCCGATGGCGAGTGATCCCTCACGATGTGCTACCGGATTGGCTTAAGGATAATGACTTCCTTCTCCATGGACACCGGCCTCCTATGCCTTCCTTTCGGGCCTGTTTTAAGAGCATTTTTAGAATACACACAGAGACGGGCAACATTTGGACACATCTCCTAGGTTGTGTATTCTTCCTGTGCCTGGGGATCTTTTATATGTTTCGCCCAAATATATCTTTTGTGGCCCCTCTGCAAGAGAAAGTGGTCTTTGGCTTGTTCTTCTTGGGAGCCATTCTCTGCCTTTCCTTTTCATGGCTCTTCCACACGGTGTACTGCCACTCAGAAGGGGTCTCCCGACTCTTCTCTAAATTGGATTACTCTGGTATTGCTCTTCTGATCATGGGAAGTTTTGTTCCTTGGCTTTATTATTCTTTCTACTGTAACCCACAACCTTGCTTCATCTACCTGATTGTCATCTGTGTGCTGGGCATTGCAGCCATTATCGTCTCTCAGTGGGACATGTTTGCCACCCCTCAGTATCGGGGGGTCAGAGCAGGAGTGTTCGTGGGCTTAGGCCTGAGTGGAATCATCCCTACCTTGCATTATGTCATCTCAGAAGGGTTCCTGAAGGCTGCCACCATAGGGCAGATAGGCTGGCTAATGCTTATGGCTAGCCTCTATATCACCGGAGCTGCCCTCTATGCGGCCCGTATCCCTGAGCGCTTCTTTCCTGGCAAATGTGACATCTGGAGCCCGGAGGAGCCCGAGTGTCATGATGACAATTCCCAGGAAGATGAAGGGTTTATGGGCATGTCCCCGCTCCTACAGGCCCATCATGCTATGGAACGAATGGAAGAGTTTGTTTGTAAGGTGTGGGAAGGCCGATGGCGAGTGATCCCTCACGATGTGCTACCGGATTGGCTTAAGGATAATGACTTCCTTCTCCATGGACACCGGCCTCCTATGCCTTCCTTTCGGGCCTGTTTTAAGAGCATTTTTAGAATACACACAGAGACGGGCAACATTTGGACACATCTCCTAGGTTGTGTATTCTTCCTGTGCCTGGGGATCTTTTATATGTTTCGCCCAAATATATCTTTTGTGGCCCCTCTGCAAGAGAAAGTGGTCTTTGGCTTGTTCTTCTTGGGAGCCATTCTCTGCCTTTCCTTTTCATGGCTCTTCCACACGGTGTACTGCCACTCAGAAGGGGTCTCCCGACTCTTCTCTAAATTGGATTACTCTGGTATTGCTCTTCTGATCATGGGAAGTTTTGTTCCTTGGCTTTATTATTCTTTCTACTGTAACCCACAACCTTGCTTCATCTACCTGATTGTCATCTGTGTGCTGGGCATTGCAGCCATTATCGTCTCTCAGTGGGACATGTTTGCCACCCCTCAGTATCGGGGGGTCAGAGCAGGAGTGTTCGTGGGCTTAGGCCTGAGTGGAATCATCCCTACCTTGCATTATGTCATCTCAGAAGGGTTCCTGAAGGCTGCCACCATAGGGCAGATAGGCTGGCTAATGCTTATGGCTAGCCTCTATATCACCGGAGCTGCCCTCTATGCGGCCCGTATCCCTGAGCGCTTCTTTCCTGGCAAATGTGACATCTGG

Peptide sequence:

MGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIW

IRESfinder result

IRESfinder score

0.63841489

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page