top of page

mmu_circAdam22_221

Basic information of circular RNA
PanCircBase ID:

mmu_circAdam22_221

mm39_Chr. Position ID:

chr5|8177326|8180535|-

Gene name:

Adam22

Transcript:

ENSMUST00000050166.14

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

21,20,19

Exon/intron offsets:

0,2882,3158

Genomic length:

3209

Exon/intron sizes in nt:

106,64,51

Flanking exon/introns:

chr5:8171167-8177326|chr5:8180535-8182398

Splice length:

221

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

TGTGCCCCCAATGTGCATAAAATGGATGGATATTCGTGTGATGGTACTCAGGGAATTTGCTTTGGAGGAAGATGTAAAACCAGAGATAGACAATGCAAATACATCTGGGGGCAAAAGGTAACAGCATCTGACAGGTACTGCTATGAGAAACTGAACATTGAGGGGACGGAGAAGGGTAACTGTGGGAAAGACAAGGACACGTGGACACAGTGCAACAAACG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

ACTGAACATTGAGGGGACGG

59.68

TCCTCCAAAGCAAATTCCCTGA

59.89

141

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CTGAACATTGAGGGGACGGA

59.39

TCCTCCAAAGCAAATTCCCTGA

59.89

140

PCR template sequence:

CAGCATCTGACAGGTACTGCTATGAGAAACTGAACATTGAGGGGACGGAGAAGGGTAACTGTGGGAAAGACAAGGACACGTGGACACAGTGCAACAAACGTGTGCCCCCAATGTGCATAAAATGGATGGATATTCGTGTGATGGTACTCAGGGAATTTGCTTTGGAGGAAGATGTAAAACCAGAGATAGACAATGCAAAT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

6

Interacting miRNAs (#binding sites)

mmu-miR-125b-5p(1), mmu-miR-363-3p(1), mmu-miR-125a-5p(1), mmu-miR-29b-1-5p(1), mmu-miR-207(1), mmu-miR-670-5p(1)

siRNAs for circular RNA silencing
Junction sequence

AGTGCAACAAACGTGTGCCCCCAATG

siRNA sets

ATTGGGGGCACACGTTTGT, TTGGGGGCACACGTTTGTT, CATTGGGGGCACACGTTTG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCADAM22_221_ORF_1

0.5064

0.068723656

0.15260094

321

ORF sequence:

ATGGATGGATATTCGTGTGATGGTACTCAGGGAATTTGCTTTGGAGGAAGATGTAAAACCAGAGATAGACAATGCAAATACATCTGGGGGCAAAAGGTAACAGCATCTGACAGGTACTGCTATGAGAAACTGAACATTGAGGGGACGGAGAAGGGTAACTGTGGGAAAGACAAGGACACGTGGACACAGTGCAACAAACGTGTGCCCCCAATGTGCATAAAATGGATGGATATTCGTGTGATGGTACTCAGGGAATTTGCTTTGGAGGAAGATGTAAAACCAGAGATAGACAATGCAAATACATCTGGGGGCAAAAGGTAA

Peptide sequence:

MDGYSCDGTQGICFGGRCKTRDRQCKYIWGQKVTASDRYCYEKLNIEGTEKGNCGKDKDTWTQCNKRVPPMCIKWMDIRVMVLREFALEEDVKPEIDNANTSGGKR

IRESfinder result

IRESfinder score

0.400618354

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page