top of page

mmu_circAdam17_1151

Basic information of circular RNA
PanCircBase ID:

mmu_circAdam17_1151

mm39_Chr. Position ID:

chr12|21390472|21411792|-

Gene name:

Adam17

Transcript:

ENSMUST00000101551.10

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

10

Exon/intron indexes:

11,10,9,8,7,6,5,4,3,2

Exon/intron offsets:

0,203,2392,5149,5545,6825,9313,11071,13411,21187

Genomic length:

21320

Exon/intron sizes in nt:

89,145,114,90,57,134,169,89,131,133

Flanking exon/introns:

chr12:21386786-21390472|chr12:21411792-21423336

Splice length:

1151

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

AGAAGCTTGATTCTTTGCTCTCAGACTACGACATCCTCTCCTTAGCTAATATTCAGCAGCACTCCATAAGGAAAAGGGATCTACAGTCTGCGACACACTTAGAAACATTACTAACTTTTTCAGCTTTGAAAAGACATTTTAAATTATACTTGACATCAAGTACCGAACGCTTTTCACAAAACTTGAGAGTCGTGGTGGTGGACGGGAAAGAAGAAAGCGAGTACAGCGTGAAGTGGCAGAACTTCTTCAGTGGTCACGTGGTTGGTGAGCCTGACTCTAGGGTTCTAGCCCACATAGGAGATGATGATGTTACAGTGAGAATCAACACAGATGGGGCAGAATATAACGTAGAGCCACTTTGGAGGTTTGTCAATGATACTAAAGATAAACGAATGCTGGTGTATAAGTCTGAAGATATCAAGGATTTTTCACGTTTGCAGTCTCCAAAAGTATGTGGTTATTTAAATGCAGATAGTGAAGAGCTGCTTCCAAAAGGGCTCATAGACAGAGAGCCATCTGAAGAGTTTGTTCGTCGAGTGAAGAGACGAGCTGAACCTAACCCCTTGAAGAATACTTGTAAATTACTGGTGGTAGCAGATCATCGATTTTATAAATACATGGGCCGTGGAGAAGAGAGCACCACTACAAATTACTTAGGCTACATTTCAGGCACTCGGGACAGAGTGACGACCGACTGCTTTTTAGAGTTTTTGATAGAGCTAATTGACCGAGTTGATGACATATACCGGAACACGTCGTGGGATAATGCAGGGTTTAAAGGGTATGGAGTGCAGATAGAGCAGATTCGAATTCTCAAGTCTCCACAAGAGGTAAAACCTGGTGAAAGACACTTCAATATGGCAAAAAGTTTCCCAAACGAAGAGAAGGATGCTTGGGATGTGAAGATGCTATTAGAGCAATTTAGCTTTGATATAGCTGAAGAAGCATCTAAAGTCTGCCTGGCTCATCTTTTCACGTACCAGGATTTTGATATGGGAACTCTTGGATTAGCTTACGTTGGTTCTCCCAGAGCAAACAGTCATGGAGGGGTTTGTCCAAAAGCTTATTACAACCCAACTGTGAAGAAAAACATCTATTTAAATAGTGGTCTGACTAGTACTAAAAATTATGGCAAAACTATTCTCACAAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

ACAACCCAACTGTGAAGAAAAACA

59.72

TCCTTATGGAGTGCTGCTGA

58.43

155

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ACAACCCAACTGTGAAGAAAAACA

59.72

TCCTTATGGAGTGCTGCTGAA

59.09

155

PCR template sequence:

TTGTCCAAAAGCTTATTACAACCCAACTGTGAAGAAAAACATCTATTTAAATAGTGGTCTGACTAGTACTAAAAATTATGGCAAAACTATTCTCACAAAGAGAAGCTTGATTCTTTGCTCTCAGACTACGACATCCTCTCCTTAGCTAATATTCAGCAGCACTCCATAAGGAAAAGGGATCTACAGTCTGCGACACACTT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

6

Interacting miRNAs (#binding sites)

mmu-miR-140-5p(1), mmu-miR-204-5p(1), mmu-miR-26b-5p(1), mmu-miR-362-5p(1), mmu-miR-207(1), mmu-miR-338-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TATTCTCACAAAGAGAAGCTTGATTC

siRNA sets

ATCAAGCTTCTCTTTGTGA, AATCAAGCTTCTCTTTGTG, GAATCAAGCTTCTCTTTGT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCADAM17_1151_ORF_1

0.812

0.086428246

0.914385989

804

ORF sequence:

ATGCTGGTGTATAAGTCTGAAGATATCAAGGATTTTTCACGTTTGCAGTCTCCAAAAGTATGTGGTTATTTAAATGCAGATAGTGAAGAGCTGCTTCCAAAAGGGCTCATAGACAGAGAGCCATCTGAAGAGTTTGTTCGTCGAGTGAAGAGACGAGCTGAACCTAACCCCTTGAAGAATACTTGTAAATTACTGGTGGTAGCAGATCATCGATTTTATAAATACATGGGCCGTGGAGAAGAGAGCACCACTACAAATTACTTAGGCTACATTTCAGGCACTCGGGACAGAGTGACGACCGACTGCTTTTTAGAGTTTTTGATAGAGCTAATTGACCGAGTTGATGACATATACCGGAACACGTCGTGGGATAATGCAGGGTTTAAAGGGTATGGAGTGCAGATAGAGCAGATTCGAATTCTCAAGTCTCCACAAGAGGTAAAACCTGGTGAAAGACACTTCAATATGGCAAAAAGTTTCCCAAACGAAGAGAAGGATGCTTGGGATGTGAAGATGCTATTAGAGCAATTTAGCTTTGATATAGCTGAAGAAGCATCTAAAGTCTGCCTGGCTCATCTTTTCACGTACCAGGATTTTGATATGGGAACTCTTGGATTAGCTTACGTTGGTTCTCCCAGAGCAAACAGTCATGGAGGGGTTTGTCCAAAAGCTTATTACAACCCAACTGTGAAGAAAAACATCTATTTAAATAGTGGTCTGACTAGTACTAAAAATTATGGCAAAACTATTCTCACAAAGAGAAGCTTGATTCTTTGCTCTCAGACTACGACATCCTCTCCTTAG

Peptide sequence:

MLVYKSEDIKDFSRLQSPKVCGYLNADSEELLPKGLIDREPSEEFVRRVKRRAEPNPLKNTCKLLVVADHRFYKYMGRGEESTTTNYLGYISGTRDRVTTDCFLEFLIELIDRVDDIYRNTSWDNAGFKGYGVQIEQIRILKSPQEVKPGERHFNMAKSFPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYNPTVKKNIYLNSGLTSTKNYGKTILTKRSLILCSQTTTSSP

IRESfinder result

IRESfinder score

0.684384341

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page