top of page

mmu_circActr10_554

Basic information of circular RNA
PanCircBase ID:

mmu_circActr10_554

mm39_Chr. Position ID:

chr12|70999723|71006816|+

Gene name:

Actr10

Transcript:

ENSMUST00000021479.6

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

7,8,9,10,11,12

Exon/intron offsets:

0,1669,3323,3650,5082,6891

Genomic length:

7093

Exon/intron sizes in nt:

80,36,80,74,82,202

Flanking exon/introns:

chr12:70996545-70999723|chr12:71006816-71008640

Splice length:

554

Other database IDs:

circAtlas: mmu-Actr10_0001

circBase: hsa_circ_0102209, circAtlas: hsa-ACTR10_0001, CIRCpedia: HSA_CIRCpedia_162598

Human Ortholog IDs:
Mature spliced Sequence:

GGAGTTGGAAACTCAGCTGTTGGAACAATGTACTGTTGACACTGGTGCAGCTAAAGGACAGAGCCTTCCCTCAGTGATGGGTTCAGTTCCAGAAGGTGTGCTAGAAGATATTAAAGTGCGCACGTGCTTTGTCAGTGATCTGAAGCGTGGACTGCAAATCCAAGCAGCAAAATTTAATATTGATGGGAATAATGAGCGTCCCACTCCACCTCCAAATGTTGACTATCCATTGGATGGAGAGAAAATTTTACATGTGCTTGGATCAATCAGAGATTCAGTTGTGGAAATCCTTTTTGAACAAGATAATGAGGAGAAGTCAGTTGCCACTTTAATTTTGGATTCCCTTTTACAGTGCCCAATAGACACCAGGAAGCAACTGGCAGAGAATTTGGTAATCATCGGTGGCACATCTATGTTGCCAGGCTTTCTCCACAGATTGCTTGCAGAAATACGGTATTTGGTAGAAAAGCCAAAGTACAAAAAGACACTTGGCACCAAGAACTTCCGAATTCATACTCCACCTGCAAAAGCTAATTGTGTGGCCTGGTTGGGAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGGCACCAAGAACTTCCGAA

59.82

TCACTGAGGGAAGGCTCTGT

60.18

142

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TTGGCACCAAGAACTTCCGA

59.82

TCACTGAGGGAAGGCTCTGT

60.18

143

PCR template sequence:

TATTTGGTAGAAAAGCCAAAGTACAAAAAGACACTTGGCACCAAGAACTTCCGAATTCATACTCCACCTGCAAAAGCTAATTGTGTGGCCTGGTTGGGAGGGAGTTGGAAACTCAGCTGTTGGAACAATGTACTGTTGACACTGGTGCAGCTAAAGGACAGAGCCTTCCCTCAGTGATGGGTTCAGTTCCAGAAGGTGTG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

4

Interacting miRNAs (#binding sites)

mmu-miR-199a-5p(1), mmu-miR-150-5p(1), mmu-miR-101a-3p(1), mmu-miR-207(1)

siRNAs for circular RNA silencing
Junction sequence

GCCTGGTTGGGAGGGAGTTGGAAACT

siRNA sets

TTCCAACTCCCTCCCAACC, TTTCCAACTCCCTCCCAAC, AGTTTCCAACTCCCTCCCA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCACTR10_554_ORF_1

0.8271

0.05934453

0.626395658

555

ORF sequence:

ATGGGTTCAGTTCCAGAAGGTGTGCTAGAAGATATTAAAGTGCGCACGTGCTTTGTCAGTGATCTGAAGCGTGGACTGCAAATCCAAGCAGCAAAATTTAATATTGATGGGAATAATGAGCGTCCCACTCCACCTCCAAATGTTGACTATCCATTGGATGGAGAGAAAATTTTACATGTGCTTGGATCAATCAGAGATTCAGTTGTGGAAATCCTTTTTGAACAAGATAATGAGGAGAAGTCAGTTGCCACTTTAATTTTGGATTCCCTTTTACAGTGCCCAATAGACACCAGGAAGCAACTGGCAGAGAATTTGGTAATCATCGGTGGCACATCTATGTTGCCAGGCTTTCTCCACAGATTGCTTGCAGAAATACGGTATTTGGTAGAAAAGCCAAAGTACAAAAAGACACTTGGCACCAAGAACTTCCGAATTCATACTCCACCTGCAAAAGCTAATTGTGTGGCCTGGTTGGGAGGGAGTTGGAAACTCAGCTGTTGGAACAATGTACTGTTGACACTGGTGCAGCTAAAGGACAGAGCCTTCCCTCAGTGA

Peptide sequence:

MGSVPEGVLEDIKVRTCFVSDLKRGLQIQAAKFNIDGNNERPTPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLLQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGSWKLSCWNNVLLTLVQLKDRAFPQ

IRESfinder result

IRESfinder score

0.678014636

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page