top of page

mmu_circActr10_484

Basic information of circular RNA
PanCircBase ID:

mmu_circActr10_484

mm39_Chr. Position ID:

chr12|70989032|71001428|+

Gene name:

Actr10

Transcript:

ENSMUST00000021479.6

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

3,4,5,6,7,8

Exon/intron offsets:

0,1150,5193,7445,10691,12360

Genomic length:

12396

Exon/intron sizes in nt:

83,109,108,68,80,36

Flanking exon/introns:

chr12:70987644-70989032|chr12:71001428-71003046

Splice length:

484

Other database IDs:

circAtlas: mmu-Actr10_0004

circBase: hsa_circ_0102204, circAtlas: hsa-ACTR10_0011, CIRCpedia: HSA_CIRCpedia_167888

Human Ortholog IDs:
Mature spliced Sequence:

CCAATCAAAGTTGTTCAGTATAATATCAATACAGAAGAATTATATTCCTACCTAAAGGAATTCATCCACATACTGTATTTCAGGCATCTGTTGGTGAATCCCAGAGACCGCCGCGTTGTGGTTATCGAGTCGGTGTTATGTCCTTCCCACTTCAGAGAGACTCTGACTCGTGTTCTTTTTAAATATTTTGAGGTTCCATCTGTCCTACTTGCTCCAAGTCATCTGATGGCACTGCTGACGCTTGGAATTAATTCGGCCATGGTCCTGGATTGTGGATATAGGGAAAGCCTGGTGTTGCCTATCTATGAAGGCATCCCAATACTGAATTGCTGGGGAGCACTGCCGTTAGGAGGAAAAGCTCTCCACAAGGAGTTGGAAACTCAGCTGTTGGAACAATGTACTGTTGACACTGGTGCAGCTAAAGGACAGAGCCTTCCCTCAGTGATGGGTTCAGTTCCAGAAGGTGTGCTAGAAGATATTAAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGCAGCTAAAGGACAGAGCC

60.04

TCACCAACAGATGCCTGAAA

57.34

168

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCAGCTAAAGGACAGAGCC

60.04

TTCACCAACAGATGCCTGAA

57.34

169

PCR template sequence:

CTGTTGGAACAATGTACTGTTGACACTGGTGCAGCTAAAGGACAGAGCCTTCCCTCAGTGATGGGTTCAGTTCCAGAAGGTGTGCTAGAAGATATTAAAGCCAATCAAAGTTGTTCAGTATAATATCAATACAGAAGAATTATATTCCTACCTAAAGGAATTCATCCACATACTGTATTTCAGGCATCTGTTGGTGAATC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

8

Interacting miRNAs (#binding sites)

mmu-miR-34c-5p(2), mmu-miR-34a-5p(2), mmu-miR-34b-5p(2), mmu-miR-200a-3p(1), mmu-miR-199a-5p(1), mmu-miR-101a-3p(1), mmu-miR-101b-3p(1), mmu-miR-532-5p(1)

siRNAs for circular RNA silencing
Junction sequence

GAAGATATTAAAGCCAATCAAAGTTG

siRNA sets

TTTGATTGGCTTTAATATC, TTGATTGGCTTTAATATCT, GATTGGCTTTAATATCTTC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCACTR10_484_ORF_1

1.0232

0.057376036

0.25098669

282

ORF sequence:

ATGGCACTGCTGACGCTTGGAATTAATTCGGCCATGGTCCTGGATTGTGGATATAGGGAAAGCCTGGTGTTGCCTATCTATGAAGGCATCCCAATACTGAATTGCTGGGGAGCACTGCCGTTAGGAGGAAAAGCTCTCCACAAGGAGTTGGAAACTCAGCTGTTGGAACAATGTACTGTTGACACTGGTGCAGCTAAAGGACAGAGCCTTCCCTCAGTGATGGGTTCAGTTCCAGAAGGTGTGCTAGAAGATATTAAAGCCAATCAAAGTTGTTCAGTATAA

Peptide sequence:

MALLTLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALPLGGKALHKELETQLLEQCTVDTGAAKGQSLPSVMGSVPEGVLEDIKANQSCSV

IRESfinder result

IRESfinder score

0.623549403

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page