top of page

mmu_circAcly_495

Basic information of circular RNA
PanCircBase ID:

mmu_circAcly_495

mm39_Chr. Position ID:

chr11|100383330|100386790|-

Gene name:

Acly

Transcript:

ENSMUST00000107389.8

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

4

Exon/intron indexes:

20,19,18,17

Exon/intron offsets:

0,1032,1379,3355

Genomic length:

3460

Exon/intron sizes in nt:

111,82,197,105

Flanking exon/introns:

chr11:100375553-100383330|chr11:100386790-100389010

Splice length:

495

Other database IDs:

CIRCpedia: MMU_CIRCpedia_38932, circAtlas: mmu-Acly_0027

CIRCpedia: HSA_CIRCpedia_78632

Human Ortholog IDs:
Mature spliced Sequence:

ATCCGCACCATAGCCATCATAGCAGAAGGTATCCCTGAGGCCCTCACACGGAAGCTCATCAAGAAGGCCGACCAGAAGGGAGTGACCATCATTGGGCCAGCTACGGTTGGGGGCATTAAGCCTGGATGCTTTAAGATCGGGAATACTGGTGGAATGCTGGACAACATCCTGGCCTCCAAACTGTACCGCCCAGGCAGCGTGGCCTACGTCTCACGTTCAGGAGGCATGTCTAATGAACTCAATAACATCATCTCTCGGACCACAGATGGTGTCTATGAGGGCGTGGCCATCGGCGGGGACAGGTACCCTGGGTCCACATTCATGGATCACGTGCTGCGCTACCAGGACACTCCAGGAGTCAAGATGATCGTAGTTCTTGGGGAGATAGGGGGCACAGAGGAATATAAGATCTGCCGGGGCATCAAGGAGGGCCGCCTCACCAAGCCAGTGGTCTGCTGGTGTATCGGGACCTGTGCCACCATGTTCTCCTCCGAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CTGGTGTATCGGGACCTGTG

59.82

CTGGCCCAATGATGGTCACT

60.03

140

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GTCTGCTGGTGTATCGGGAC

60.18

CTGGCCCAATGATGGTCACT

60.03

145

PCR template sequence:

AGAGGAATATAAGATCTGCCGGGGCATCAAGGAGGGCCGCCTCACCAAGCCAGTGGTCTGCTGGTGTATCGGGACCTGTGCCACCATGTTCTCCTCCGAGATCCGCACCATAGCCATCATAGCAGAAGGTATCCCTGAGGCCCTCACACGGAAGCTCATCAAGAAGGCCGACCAGAAGGGAGTGACCATCATTGGGCCAG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-339-5p(1), mmu-miR-149-5p(1)

siRNAs for circular RNA silencing
Junction sequence

GTTCTCCTCCGAGATCCGCACCATAG

siRNA sets

ATGGTGCGGATCTCGGAGG, TATGGTGCGGATCTCGGAG, TGGTGCGGATCTCGGAGGA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCACLY_495_ORF_1

1.1551

0.497568638

0.993009744

837

ORF sequence:

ATGCTGGACAACATCCTGGCCTCCAAACTGTACCGCCCAGGCAGCGTGGCCTACGTCTCACGTTCAGGAGGCATGTCTAATGAACTCAATAACATCATCTCTCGGACCACAGATGGTGTCTATGAGGGCGTGGCCATCGGCGGGGACAGGTACCCTGGGTCCACATTCATGGATCACGTGCTGCGCTACCAGGACACTCCAGGAGTCAAGATGATCGTAGTTCTTGGGGAGATAGGGGGCACAGAGGAATATAAGATCTGCCGGGGCATCAAGGAGGGCCGCCTCACCAAGCCAGTGGTCTGCTGGTGTATCGGGACCTGTGCCACCATGTTCTCCTCCGAGATCCGCACCATAGCCATCATAGCAGAAGGTATCCCTGAGGCCCTCACACGGAAGCTCATCAAGAAGGCCGACCAGAAGGGAGTGACCATCATTGGGCCAGCTACGGTTGGGGGCATTAAGCCTGGATGCTTTAAGATCGGGAATACTGGTGGAATGCTGGACAACATCCTGGCCTCCAAACTGTACCGCCCAGGCAGCGTGGCCTACGTCTCACGTTCAGGAGGCATGTCTAATGAACTCAATAACATCATCTCTCGGACCACAGATGGTGTCTATGAGGGCGTGGCCATCGGCGGGGACAGGTACCCTGGGTCCACATTCATGGATCACGTGCTGCGCTACCAGGACACTCCAGGAGTCAAGATGATCGTAGTTCTTGGGGAGATAGGGGGCACAGAGGAATATAAGATCTGCCGGGGCATCAAGGAGGGCCGCCTCACCAAGCCAGTGGTCTGCTGGTGTATCGGGACCTGTGCCACCATGTTCTCCTCCGAG

Peptide sequence:

MLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPVVCWCIGTCATMFSSEIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPVVCWCIGTCATMFSSE

IRESfinder result

IRESfinder score

0.431751657

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page